DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and TBC1D3G

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:XP_005276971.1 Gene:TBC1D3G / 101060321 HGNCID:29860 Length:610 Species:Homo sapiens


Alignment Length:397 Identity:88/397 - (22%)
Similarity:148/397 - (37%) Gaps:93/397 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GPEQ---SSNKLLSIPFVE---------DAQQRLQWIAHLEFSHNKEAAEL--SWEHVDVMLPRT 154
            ||.|   ||:.|..:|:.|         :|:|     ...|.|...:..::  .||    ....:
Human    97 GPLQAPCSSSALPGLPYSETELPPLTAREAKQ-----IRREISRKSKWVDMLGDWE----KYKSS 152

  Fly   155 EKLRNMVRQGIPHTLRAQMWMRLSGALAKKQKSETSYHDIVKASSNDQLMTSKQIEKDLLRILPT 219
            .||.:...:|:|..:|..||..|......|.|:...| .|:|..........::|::|:...|..
Human   153 RKLIDRAYKGMPMNIRGPMWSVLLNIEEMKLKNPGRY-QIMKEKGKRSSEHIQRIDRDISGTLRK 216

  Fly   220 NACFSNPNGTGIPRLRRILRGIAWLFPDIGYCQGTGVIVACLLLFMEEENAFWMMATIVEDLLPA 284
            :..|.:..||....|..||.......|::|||:....|.|..||::.||:|||.:.    .||.:
Human   217 HMFFRDRYGTKQRELLHILLAYEEYNPEVGYCRDLSHIAALFLLYLPEEDAFWALV----QLLAS 277

  Fly   285 SYYS---------STLLGIQADQRVMHTLIANYLSSVDESLRKHDIELSLITLHWFLTLFANVVH 340
            ..:|         .|:.|:|..|.  |.:..:...::....:| |:......|...:.:..:.:.
Human   278 ERHSLQGFHSPNGGTVQGLQDQQE--HVVATSQPKTMGHQDKK-DLCGQCSPLGCLIRILIDGIS 339

  Fly   341 MKILVRIWDWFFYEGSIVLFQLTLGMLKV--------------------------KEQD--LKHL 377
            :.:.:|:||.:..||...|..:|....||                          :::|  ||||
Human   340 LGLTLRLWDVYLVEGEQALMPITRIAFKVQQKRLTKTSRCGPWARFCNRFVDTWARDEDTVLKHL 404

  Fly   378 ENS-AQIFNSLSDIPGEVTDVEVLFRQALEVGGSLSQTVIDTHRRRHLAYLMADQGHQI---GNP 438
            ..| .::.....|:|.....         |.|.|.|:.|            .|.:|.:.   |:.
Human   405 RASMKKLTRKQGDLPPPAKP---------EQGSSASRPV------------PASRGGKTLCKGDR 448

  Fly   439 EAAPNLP 445
            :|.|..|
Human   449 QAPPGPP 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 54/250 (22%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
TBC1D3GXP_005276971.1 TBC 160..373 CDD:214540 53/220 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.