DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and tbc1d14

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:XP_004911305.1 Gene:tbc1d14 / 100489752 XenbaseID:XB-GENE-991334 Length:794 Species:Xenopus tropicalis


Alignment Length:371 Identity:84/371 - (22%)
Similarity:151/371 - (40%) Gaps:88/371 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 AELASGPNDQPEYRFDEFGFRVEEEDGPEQSSNKLLSIPFVEDAQQR---LQWIAHLEFSHNKEA 139
            |.|.:.|.::.:..      |:|.|:...|:..:..     :|||:|   |:....||.|...  
 Frog   422 ANLPAKPAEEAQKH------RLEYEEMVAQAKRREF-----KDAQRRKKQLEERCKLEESIGN-- 473

  Fly   140 AELSWEHVDVMLPRTE------KLRNMVRQGIPHTLRAQMWMRLSGALAKKQKSETSYHDIVKAS 198
            |.|:|.  ..:||..|      ::|:|..||||.::|.::|   |.|:..:.......:||..:.
 Frog   474 AALTWN--TEILPNWETMCCSRRVRDMWWQGIPPSVRGRVW---SLAIGNELNITHDLYDICLSR 533

  Fly   199 SNDQL-----------------------MTSKQIEKDLLRILPTNACFSNPNGTGIPRLRRILRG 240
            :.|:.                       .:.:.|:.|:.|..| |.|.....|.....|..||..
 Frog   534 AKDRWKSLSMGTQEADNEDSGLSVADREASLESIKLDISRTFP-NLCIFQRGGPYHDMLHSILGA 597

  Fly   241 IAWLFPDIGYCQGTGVIVACLLLFMEEENAFWMMATIVEDLLPASYYSSTLLGIQADQRVMHTLI 305
            .....||:||.||...|.|.|:|.::..:||...:.::......:::           ||.|.|:
 Frog   598 YTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAFF-----------RVDHGLM 651

  Fly   306 ANYLSS----VDESL-------RKHDIELSLITLHWFLTLFANVVHMKILVRIWDWFFYEGSIVL 359
            ..|.::    .:|:|       :|:::...:..:.|..||::..:.:.:..|:||.|..:|...|
 Frog   652 LTYFAAFEVFFEENLPKLFAHFKKNNLTPDIYLIDWIFTLYSKSLPLDLACRVWDVFCRDGEEFL 716

  Fly   360 FQLTLGMLKVKEQDLKHLE---------------NSAQIFNSLSDI 390
            |...||:|::.|..|..::               ||..:|.|::.|
 Frog   717 FSTALGILRLFEDILTRMDFIHIAQFLTKLPEDLNSEDLFASIAAI 762

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 55/247 (22%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
tbc1d14XP_004911305.1 TBC 499..731 CDD:214540 55/246 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.