DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and tbc1d2b

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:XP_002666912.2 Gene:tbc1d2b / 100330777 ZFINID:ZDB-GENE-100922-148 Length:946 Species:Danio rerio


Alignment Length:428 Identity:130/428 - (30%)
Similarity:205/428 - (47%) Gaps:76/428 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 PNDQPEYRFDEFGFRV--EEEDGPEQSSNK-----LLSIPFV-EDAQQRLQWIAHLEFSHNKEAA 140
            ||...||  |.:||:.  ||||..|:...|     |.|:... ::...|::|..:|..:.|:|  
Zfish   571 PNAVSEY--DIYGFKTVPEEEDEEEKLEAKKRALDLKSLSLTDQETSVRVKWDNYLAITMNRE-- 631

  Fly   141 ELSWEHVDVMLPRTEKLRNMVRQGIPHTLRAQMWMRLSGALAKKQKS---ETSYHDIVKASSNDQ 202
                      :.|:..|:.::|.|:||..|:::|........||.:.   :..||:::..:::..
Zfish   632 ----------MVRSPDLKALMRGGVPHIHRSKVWSWCVSFHVKKMRDCQPKDYYHNLLCMANDKP 686

  Fly   203 LMTSKQIEKDLLRILPTNACFSNPNGTGIPRLRRILRGIAWLFPDIGYCQGTGVIVACLLLFMEE 267
            ....||||.||||.||.|..:|:|:..||.:||.:|...:|..||||||||...:.|..||::::
Zfish   687 NPACKQIELDLLRTLPNNKHYSSPDSDGIQKLRNVLLAFSWRNPDIGYCQGLNRLAAIALLYLDQ 751

  Fly   268 ENAFWMMATIVEDLLPASYYSSTLLGIQADQRVMHTLIANYLSSVDESLRKHDIELSLITLHWFL 332
            |:|||.:..|||..:|..||:.||||.|.||||...|:...|..:......:.::.||||.:|||
Zfish   752 EDAFWCLVAIVEVFMPHDYYTKTLLGSQVDQRVFKDLMYEKLPRLHAHFEHYKVDFSLITFNWFL 816

  Fly   333 TLFANVVHMKILVRIWDWFFYEGSIVLFQLTLGMLKVKEQDLKHLENSAQIFNSLSDIPGEVTDV 397
            .:|.:.|...||.:|||.|.|||..::|:..|.:.|.||::...|::...||..|.         
Zfish   817 VVFVDSVVSDILFKIWDSFLYEGPKIIFRFALALFKYKEEEFLKLQDPMTIFKYLR--------- 872

  Fly   398 EVLFRQALEVGGSLSQTVIDTHRRRHLAYLMADQGHQIGNPEAAPNLPKQQLARR------QVRK 456
                        ..::|::|.  |:.:|....|.     ||     .|.:|:..|      :||.
Zfish   873 ------------YFTRTILDA--RKLMAMAFVDM-----NP-----FPLRQIQNRRTFHLEKVRL 913

  Fly   457 SKSILEAFLFRGDGNEGDQLKNKNIRQTEILVDLREAI 494
            ..:.|||            ::...:|:.|..:|.|..|
Zfish   914 ELTELEA------------IRQTFLRERESTMDGRTLI 939

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 84/216 (39%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
tbc1d2bXP_002666912.2 PH_TBC1D2A 37..137 CDD:269966
PH 37..129 CDD:278594
CtIP_N 307..415 CDD:287457
TPR_MLP1_2 313..434 CDD:285204
USP8_interact 317..>359 CDD:286082
TBC 643..859 CDD:214540 84/215 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.