DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4210 and GNA1

DIOPT Version :9

Sequence 1:NP_650430.1 Gene:CG4210 / 41832 FlyBaseID:FBgn0038302 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_116637.1 Gene:GNA1 / 850529 SGDID:S000001877 Length:159 Species:Saccharomyces cerevisiae


Alignment Length:151 Identity:35/151 - (23%)
Similarity:64/151 - (42%) Gaps:13/151 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKSGEFTFRRALAEDIKDVLSMIQELADFEKMSNGPQLTEEDLK--RDAGLTGGQEYCEV---- 59
            ||....|..||....|::.|...::.|.....::  |:...:.:|  .:|.:....|..::    
Yeast     1 MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTIT--PESFSKLIKYWNEATVWNDNEDKKIMQYN 63

  Fly    60 -YVLVDNDTD--QAIGYSICYKAYSTWQGRYFFVEDIYVRPEHRKRGAGKRIFLEVASRAVELQC 121
             .|:||..|:  .|.|..|..:......|....:|||.|..:::.:|.||.:..::.:...:..|
Yeast    64 PMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDYGC 128

  Fly   122 PRLEFNVLEWNPARKFYESLG 142
            .::..:..|.|.  ||||..|
Yeast   129 YKIILDCDEKNV--KFYEKCG 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4210NP_650430.1 Acetyltransf_1 65..142 CDD:278980 19/78 (24%)
GNA1NP_116637.1 NAT_SF 5..155 CDD:418431 33/147 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.