DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4210 and AT2G39020

DIOPT Version :9

Sequence 1:NP_650430.1 Gene:CG4210 / 41832 FlyBaseID:FBgn0038302 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_181435.1 Gene:AT2G39020 / 818488 AraportID:AT2G39020 Length:236 Species:Arabidopsis thaliana


Alignment Length:193 Identity:48/193 - (24%)
Similarity:84/193 - (43%) Gaps:49/193 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RRALAEDIKDVLSMIQELADFEKMSNGPQLTEEDLKRDAGLTGGQEYCEVYVL------------ 62
            |.|...|:..:..:|.::|.||::::....||..|......:...:...|::|            
plant    35 RLATPSDVPFIHKLIHQMAVFERLTHLFSATESGLASTLFTSRPFQSFTVFLLEVSRSPFPATIT 99

  Fly    63 -------------------VD------------NDTDQAIGYSICYKAYSTWQGR-YFFVEDIYV 95
                               :|            ||...| |:.:.:..||::..: .|::|||:|
plant   100 SSPSPDFTPFFKTHNLDLPIDDPESYNFSPDMLNDVVVA-GFVLFFPNYSSFLSKPGFYIEDIFV 163

  Fly    96 RPEHRKRGAGKRIFLEVASRAVELQCPRLEFNVLEWN-PARKFYESLGAVDLTDKEGWHYYRV 157
            |..:|::|.|..:...||.:||::...|:|:.||:|| .|.||||.:||..|.:   |...|:
plant   164 REPYRRKGFGSMLLTAVAKQAVKMGYGRVEWVVLDWNVNAIKFYEQMGAQILQE---WRVCRL 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4210NP_650430.1 Acetyltransf_1 65..142 CDD:278980 30/78 (38%)
AT2G39020NP_181435.1 RimI <132..211 CDD:223532 30/79 (38%)
Acetyltransf_1 136..213 CDD:278980 29/77 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 55 1.000 Domainoid score I4113
eggNOG 1 0.900 - - E1_COG0454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1228251at2759
OrthoFinder 1 1.000 - - FOG0000765
OrthoInspector 1 1.000 - - otm3338
orthoMCL 1 0.900 - - OOG6_102027
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X727
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.680

Return to query results.
Submit another query.