DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4210 and Satl1

DIOPT Version :9

Sequence 1:NP_650430.1 Gene:CG4210 / 41832 FlyBaseID:FBgn0038302 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_082931.1 Gene:Satl1 / 73809 MGIID:1921059 Length:744 Species:Mus musculus


Alignment Length:169 Identity:55/169 - (32%)
Similarity:88/169 - (52%) Gaps:4/169 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SGEFTFRRALAEDIKDVLSMIQELADFEKMSNGPQLTEEDLKRDAGLTGGQEYCEVYVLVDNDTD 68
            |..|..|.|..||..|:|.:|:|||.:|.|.....|||.||.||........||.|.......|:
Mouse   575 SCSFFIRPAEPEDCPDILRLIKELASYEGMEEKVSLTERDLFRDGFGDNPLFYCLVAEAPSEQTE 639

  Fly    69 ---QAIGYSICYKAYSTWQGRYFFVEDIYVRPEHRKRGAGKRIFLEVASRAVELQCPRLEFNVLE 130
               :.||:::.|..|....|:...:||.|:..:::..|.|..:..:::..|:..:|..::|.|:.
Mouse   640 SGVKTIGFAMYYFTYDPRIGKLLHLEDFYITEDYQGIGIGADMLKKLSQIAINTECCGMQFLVII 704

  Fly   131 WN-PARKFYESLGAVDLTDKEGWHYYRVEEQQLAKLAAD 168
            || .:.::|..|||:||:.:||||.:|.....|.:||.:
Mouse   705 WNQDSVEYYTRLGALDLSCEEGWHLFRFNLDDLLELAEE 743

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG4210NP_650430.1 Acetyltransf_1 65..142 CDD:278980 18/80 (23%)
Satl1NP_082931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..271
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..425