DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4210 and sat1a.1

DIOPT Version :9

Sequence 1:NP_650430.1 Gene:CG4210 / 41832 FlyBaseID:FBgn0038302 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001025370.1 Gene:sat1a.1 / 565700 ZFINID:ZDB-GENE-050913-41 Length:171 Species:Danio rerio


Alignment Length:167 Identity:55/167 - (32%)
Similarity:92/167 - (55%) Gaps:5/167 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FTFRRALAEDIKDVLSMIQELADFEKMSNGPQLTEEDLKRDAGLTGGQEYCEVYVLVDN----DT 67
            :..|:|..:|:.|:|.:|:|||.||:|.:...|||:||..|........:|.|..:...    |.
Zfish     4 YILRKAEPKDVSDILRLIKELAKFEEMEDQVILTEKDLLEDGFGDHPFYHCMVAEVAKQHQSADG 68

  Fly    68 DQAIGYSICYKAYSTWQGRYFFVEDIYVRPEHRKRGAGKRIFLEVASRAVELQCPRLEFNVLEWN 132
            ...:|:::.|..|..|.|:..::||.||..|:|..|.|..|..:::..||..:|..:.|.|.|||
Zfish    69 HVIVGFAMYYFTYDPWIGKLLYLEDFYVMKEYRGFGIGSEILKKLSQTAVRTRCSSMHFIVAEWN 133

  Fly   133 PAR-KFYESLGAVDLTDKEGWHYYRVEEQQLAKLAAD 168
            ... :||:..||.||:.:|||..:::::|.|.|:.::
Zfish   134 TTSIEFYKRRGASDLSHEEGWRLFKIDKQSLLKMTSE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4210NP_650430.1 Acetyltransf_1 65..142 CDD:278980 25/81 (31%)
sat1a.1NP_001025370.1 RimI 4..144 CDD:223532 45/139 (32%)
Acetyltransf_1 67..144 CDD:278980 25/76 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592723
Domainoid 1 1.000 72 1.000 Domainoid score I9260
eggNOG 1 0.900 - - E1_COG0454
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4729
OMA 1 1.010 - - QHG62030
OrthoDB 1 1.010 - - D1228251at2759
OrthoFinder 1 1.000 - - FOG0000765
OrthoInspector 1 1.000 - - otm25660
orthoMCL 1 0.900 - - OOG6_102027
Panther 1 1.100 - - O PTHR10545
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X727
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.