DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4210 and Gnpnat1

DIOPT Version :9

Sequence 1:NP_650430.1 Gene:CG4210 / 41832 FlyBaseID:FBgn0038302 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_062298.1 Gene:Gnpnat1 / 54342 MGIID:1858963 Length:184 Species:Mus musculus


Alignment Length:134 Identity:32/134 - (23%)
Similarity:51/134 - (38%) Gaps:27/134 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VLSMIQELADFEKMSNGPQ---LTEEDLKRDAGLTGGQEYCEVYVLVDNDTDQAIGYSICYKAYS 81
            |:|..|.:..||.|.....   ...||      :|.||......:::::....:     |.|   
Mouse    65 VVSPEQFMKSFEHMKKSGDYYVTVVED------VTLGQIVATATLIIEHKFIHS-----CAK--- 115

  Fly    82 TWQGRYFFVEDIYVRPEHRKRGAGKRIFLEVASRAVELQCPRLEFNVLEWNPARKFYESLGAVDL 146
              :||   |||:.|..|.|.:..||.:...:...:.:|.|.::....|..|..  ||:..   |.
Mouse   116 --RGR---VEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVG--FYKKF---DY 170

  Fly   147 TDKE 150
            |..|
Mouse   171 TVSE 174

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG4210NP_650430.1 Acetyltransf_1 65..142 CDD:278980 18/76 (24%)
Gnpnat1NP_062298.1 NAT_SF 36..174 CDD:418431 31/132 (23%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q96EK6 108..111 0/2 (0%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q96EK6 120..122 1/1 (100%)
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q96EK6 130..135 0/4 (0%)