DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4210 and sat1

DIOPT Version :9

Sequence 1:NP_650430.1 Gene:CG4210 / 41832 FlyBaseID:FBgn0038302 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001007997.1 Gene:sat1 / 493359 XenbaseID:XB-GENE-1002781 Length:171 Species:Xenopus tropicalis


Alignment Length:172 Identity:66/172 - (38%)
Similarity:97/172 - (56%) Gaps:13/172 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EFTFRRALAEDIKDVLSMIQELADFEKMSNGPQLTEEDLKRDAGLTGGQEYCEVYVL---VDNDT 67
            :|..|.|.|.|.||:|.:|:|||.:|.|.|...|||:||..|    |..|:...:.|   |..:|
 Frog     3 KFIIRSANAGDCKDILRLIKELAKYEDMENQVVLTEKDLLED----GFGEHPFYHCLVAEVPKET 63

  Fly    68 DQAIGYSIC-----YKAYSTWQGRYFFVEDIYVRPEHRKRGAGKRIFLEVASRAVELQCPRLEFN 127
            ..|.||:|.     |..|..|.|:..::||.:|..|.|..|.|..||..::..|::.:|..:.|.
 Frog    64 QSADGYTIVGFAMYYFTYDPWIGKLLYLEDFFVMDEFRGFGMGSEIFKHLSQIAMKCRCSSMHFL 128

  Fly   128 VLEWN-PARKFYESLGAVDLTDKEGWHYYRVEEQQLAKLAAD 168
            |.||| |:.|||:..||.||:.:|||..::::::.|.||||:
 Frog   129 VAEWNEPSIKFYKRRGAADLSTEEGWRLFKIDKEYLCKLAAE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4210NP_650430.1 Acetyltransf_1 65..142 CDD:278980 29/82 (35%)
sat1NP_001007997.1 Acetyltransf_1 27..144 CDD:366181 42/120 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8368
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4607
OMA 1 1.010 - - QHG62030
OrthoDB 1 1.010 - - D1228251at2759
OrthoFinder 1 1.000 - - FOG0000765
OrthoInspector 1 1.000 - - otm47983
Panther 1 1.100 - - O PTHR10545
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X727
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.