DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4210 and aanat1

DIOPT Version :9

Sequence 1:NP_650430.1 Gene:CG4210 / 41832 FlyBaseID:FBgn0038302 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_956998.1 Gene:aanat1 / 393677 ZFINID:ZDB-GENE-040329-1 Length:204 Species:Danio rerio


Alignment Length:106 Identity:17/106 - (16%)
Similarity:43/106 - (40%) Gaps:20/106 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ADFEKMSNGPQLTEEDLKRDAGLTGGQEYCEVYVLVDNDTDQAIGY-SICYKAYSTW--QGRY-- 87
            ::|..::....::..:::|:|.::...| |.:::      |:...: ::|.:....|  |||.  
Zfish    32 SEFRSLNAEDAISVFEIEREAFISVSGE-CPLHL------DEVRHFLTLCPELSLGWFEQGRLVA 89

  Fly    88 FFVEDIYVRPE--------HRKRGAGKRIFLEVASRAVELQ 120
            |.:..::.:..        |:..|....|.:....|....|
Zfish    90 FIIGSLWDQDRLTADALTLHKPHGTTVHIHVLAVHRTFRQQ 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4210NP_650430.1 Acetyltransf_1 65..142 CDD:278980 12/69 (17%)
aanat1NP_956998.1 RimI 30..200 CDD:223532 17/106 (16%)
Acetyltransf_1 82..171 CDD:278980 9/49 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.