DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4210 and Sat2

DIOPT Version :9

Sequence 1:NP_650430.1 Gene:CG4210 / 41832 FlyBaseID:FBgn0038302 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_038942244.1 Gene:Sat2 / 360547 RGDID:1307869 Length:189 Species:Rattus norvegicus


Alignment Length:181 Identity:61/181 - (33%)
Similarity:92/181 - (50%) Gaps:24/181 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RRALAEDIKDVLSMIQELADFEKMSNGPQLTEED-------------------LKRDAGLTGGQE 55
            |.|...|..|::.||:|||:|||:|:..:::||.                   |:.|........
  Rat     7 REAKESDCGDIMRMIRELAEFEKLSHQVKISEEGSRPSPPPSAFFVIPPISVALRADGFGENPFF 71

  Fly    56 YCEVYVLV----DNDTDQAIGYSICYKAYSTWQGRYFFVEDIYVRPEHRKRGAGKRIFLEVASRA 116
            :|.|..::    :......:||.:.|..||||.||..::|||||.|::|.:|.|.:|..:||..|
  Rat    72 HCLVAEIIPAPGEPQGSLVVGYGLYYFIYSTWTGRNIYLEDIYVMPKYRGQGIGTKIIKKVAEVA 136

  Fly   117 VELQCPRLEFNVLEWN-PARKFYESLGAVDLTDKEGWHYYRVEEQQLAKLA 166
            :...|.:....||.|| .|...|:.|||.|||:.|||..:|.|.:.:.:||
  Rat   137 LRKGCSQFRLAVLNWNKKAVNLYKFLGAQDLTESEGWLSFRFEGEAMRELA 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4210NP_650430.1 Acetyltransf_1 65..142 CDD:278980 29/77 (38%)
Sat2XP_038942244.1 Acetyltransf_1 <90..163 CDD:395465 29/72 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351007
Domainoid 1 1.000 64 1.000 Domainoid score I9884
eggNOG 1 0.900 - - E1_COG0454
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H44215
Inparanoid 1 1.050 111 1.000 Inparanoid score I4777
OMA 1 1.010 - - QHG62030
OrthoDB 1 1.010 - - D1228251at2759
OrthoFinder 1 1.000 - - FOG0000765
OrthoInspector 1 1.000 - - otm44929
orthoMCL 1 0.900 - - OOG6_102027
Panther 1 1.100 - - LDO PTHR10545
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X727
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.