DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4210 and D2023.4

DIOPT Version :9

Sequence 1:NP_650430.1 Gene:CG4210 / 41832 FlyBaseID:FBgn0038302 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_505978.1 Gene:D2023.4 / 183946 WormBaseID:WBGene00008408 Length:160 Species:Caenorhabditis elegans


Alignment Length:150 Identity:52/150 - (34%)
Similarity:87/150 - (57%) Gaps:7/150 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KDVLSMIQELADFEKMSNGPQLTEEDLKRDAGLTGGQEYCEVYVLVDNDTDQAIGYSICYKAYST 82
            :.::|||.|||:||||.:....|.|.|::|.      |...|:..:....::..|.::.|.||||
 Worm    15 EQLISMIHELAEFEKMKSSVVNTAEKLRKDI------ENKAVHGFIAFIGEEPAGMNLFYYAYST 73

  Fly    83 WQGRYFFVEDIYVRPEHRKRGAGKRIFLEVASRAVELQCPRLEFNVLEWNP-ARKFYESLGAVDL 146
            |.|:|..:||:|:||:.|:.|..:.::.::|..|.:....|||:.||:||. |...|:::..|:|
 Worm    74 WVGQYLHMEDLYIRPQFRRMGLARTLWKKLAELARDKGIVRLEWAVLDWNKNAIALYDTVDYVNL 138

  Fly   147 TDKEGWHYYRVEEQQLAKLA 166
            |..|||..:|::...:.|.|
 Worm   139 TKSEGWFTFRMDGAAINKFA 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4210NP_650430.1 Acetyltransf_1 65..142 CDD:278980 27/77 (35%)
D2023.4NP_505978.1 Acetyltransf_1 18..130 CDD:395465 42/117 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165248
Domainoid 1 1.000 61 1.000 Domainoid score I6968
eggNOG 1 0.900 - - E1_COG0454
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H44215
Inparanoid 1 1.050 95 1.000 Inparanoid score I3629
Isobase 1 0.950 - 0 Normalized mean entropy S4156
OMA 1 1.010 - - QHG62030
OrthoDB 1 1.010 - - D1228251at2759
OrthoFinder 1 1.000 - - FOG0000765
OrthoInspector 1 1.000 - - oto19481
orthoMCL 1 0.900 - - OOG6_102027
Panther 1 1.100 - - LDO PTHR10545
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R122
SonicParanoid 1 1.000 - - X727
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1615.790

Return to query results.
Submit another query.