powered by:
Protein Alignment CG4210 and flp-24
DIOPT Version :9
Sequence 1: | NP_650430.1 |
Gene: | CG4210 / 41832 |
FlyBaseID: | FBgn0038302 |
Length: | 174 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_497243.3 |
Gene: | flp-24 / 182824 |
WormBaseID: | WBGene00016028 |
Length: | 69 |
Species: | Caenorhabditis elegans |
Alignment Length: | 34 |
Identity: | 12/34 - (35%) |
Similarity: | 17/34 - (50%) |
Gaps: | 2/34 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 112 VASRAVELQCPRLEFNVLEWNPARKF-YESLGAV 144
||..|| .||..::::|.|..|...| |...|.:
Worm 17 VAIMAV-AQCRNIQYDVEEMTPEAAFRYAQWGEI 49
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG4210 | NP_650430.1 |
Acetyltransf_1 |
65..142 |
CDD:278980 |
11/30 (37%) |
flp-24 | NP_497243.3 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0454 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.