DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4210 and gna-2

DIOPT Version :9

Sequence 1:NP_650430.1 Gene:CG4210 / 41832 FlyBaseID:FBgn0038302 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_492144.1 Gene:gna-2 / 172533 WormBaseID:WBGene00001647 Length:347 Species:Caenorhabditis elegans


Alignment Length:114 Identity:27/114 - (23%)
Similarity:49/114 - (42%) Gaps:18/114 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RALAEDIKDVLSMIQELADFEKMSNGPQLTEEDLKRDAGLTGGQEYCEVYVLVDNDTDQAIG--- 72
            |||..|..:.|.::::|.     |.| .:|:.|.::........|...:.||.|.::.:.:|   
 Worm   201 RALRSDDMNYLKLLEQLT-----SVG-YVTKNDFEQRFSTMKNSESYFIVVLEDVNSSKIVGAAT 259

  Fly    73 --YSICYKAYSTWQGRYFFVEDIYVRPEHRKRGAGKRIFLEVASRAVEL 119
              ..:.|......:||   |||:.|....|    |||:.:.:....|::
 Worm   260 LVVELKYIHECGLRGR---VEDVVVDLTMR----GKRLGILINEALVKM 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4210NP_650430.1 Acetyltransf_1 65..142 CDD:278980 13/60 (22%)
gna-2NP_492144.1 NAT_SF 22..153 CDD:388411
NAT_SF 198..338 CDD:388411 27/114 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.