DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4210 and nat8.6

DIOPT Version :9

Sequence 1:NP_650430.1 Gene:CG4210 / 41832 FlyBaseID:FBgn0038302 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_004911369.1 Gene:nat8.6 / 101731538 XenbaseID:XB-GENE-22166529 Length:299 Species:Xenopus tropicalis


Alignment Length:141 Identity:33/141 - (23%)
Similarity:47/141 - (33%) Gaps:50/141 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ALAEDIKDVLS--MIQELADFEKMSNGPQLTEEDLKRDAGLTGGQ-------EYCEVYVLVDND- 66
            ||..|:.|:..  |:.|.|.|       .:.|.| ::..|..|.|       |...:::.|..| 
 Frog   169 ALRNDMLDIEKSYMMSENACF-------WVAEID-RKVVGTVGAQPSTDADDELLLLHISVARDY 225

  Fly    67 TDQAIGYSICYKAYSTWQGRYFFVEDIYVRPEHRKRGAGKRIFLEVASRAVELQCPRLEFNVLEW 131
            ..|.||..:|..           |.|.     .|:||     |..|......:|           
 Frog   226 RQQRIGTKLCQT-----------VIDF-----ARQRG-----FNAVCLETANIQ----------- 258

  Fly   132 NPARKFYESLG 142
            :.|...|||:|
 Frog   259 HAAINLYESVG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4210NP_650430.1 Acetyltransf_1 65..142 CDD:278980 17/77 (22%)
nat8.6XP_004911369.1 Acetyltransf_1 193..271 CDD:278980 25/110 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1228251at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.