DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6654 and ZBTB22

DIOPT Version :9

Sequence 1:	NP_650429.1	Gene:	CG6654 / 41831	FlyBaseID:	FBgn0038301	Length:	639	Species:	Drosophila melanogaster
Sequence 2:	NP_001138810.1	Gene:	ZBTB22 / 9278	HGNCID:	13085	Length:	634	Species:	Homo sapiens

Alignment Length:	87	Identity:	33/87 - (37%)
Similarity:	47/87 - (54%)	Gaps:	5/87 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   436 GEKPFVCNICGKSFTQNANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEV 500
            |.|.|:|: |||:|:..:...:|...|...:.|.|.:|...|..|..||.|.:||||.||:||.|
Human   482 GNKIFLCH-CGKAFSHKSMRDRHVNMHLNLRPFDCPVCNKKFKMKHHLTEHMKTHTGLKPYECGV 545

  Fly   501 CLARFTTSCSLAKHK----RKH 518
            |..:|....|..:|:    |:|
Human   546 CAKKFMWRDSFMRHRGHCERRH 567

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6654	NP_650429.1	zf-AD	6..79	CDD:285071
		C2H2 Zn finger	331..354	CDD:275368
		COG5048	<357..570	CDD:227381	33/87 (38%)
		C2H2 Zn finger	360..380	CDD:275368
		C2H2 Zn finger	385..406	CDD:275370
		C2H2 Zn finger	414..434	CDD:275368
		zf-H2C2_2	427..451	CDD:290200	8/14 (57%)
		C2H2 Zn finger	442..490	CDD:275368	15/47 (32%)
		C2H2 Zn finger	470..487	CDD:275368	6/16 (38%)
		zf-H2C2_2	482..507	CDD:290200	14/24 (58%)
		C2H2 Zn finger	498..518	CDD:275368	7/23 (30%)
		zf-H2C2_2	510..534	CDD:290200	4/13 (31%)
		C2H2 Zn finger	526..546	CDD:275368
		zf-H2C2_2	539..563	CDD:290200
		C2H2 Zn finger	554..574	CDD:275368
		C2H2 Zn finger	582..602	CDD:275368
ZBTB22	NP_001138810.1	BTB	47..149	CDD:306997
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	167..247
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	308..461
		C2H2 Zn finger	488..507	CDD:275368	6/19 (32%)
		zf-C2H2	513..535	CDD:306579	8/21 (38%)
		C2H2 Zn finger	515..535	CDD:275368	7/19 (37%)
		zf-H2C2_2	527..550	CDD:316026	13/22 (59%)
		C2H2 Zn finger	543..567	CDD:275368	7/23 (30%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	568..634		33/87 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000