DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6654 and INSM2

DIOPT Version :9

Sequence 1:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_115983.3 Gene:INSM2 / 84684 HGNCID:17539 Length:566 Species:Homo sapiens


Alignment Length:408 Identity:95/408 - (23%)
Similarity:135/408 - (33%) Gaps:106/408 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 LEKEQVP-----QSAKRTS--RRRGVVKQDVPATPPSDAEPSPKQHR-------------LGTQR 302
            |:.:..|     ||.||.:  .|||....|..:.|.:.....||..|             ||.:.
Human   177 LQPDPAPLSAALQSLKRAAGGERRGKAPTDCASGPAAAGIKKPKAMRKLSFADEVTTSPVLGLKI 241

  Fly   303 KLSAPRAGTVNGPSTTSGAATTPELKYHCDRCNAGFAVEKSLMIHRRQKGCINRNYKCNECEKVF 367
            |...|.|     ||...|.:.||..::.|..|...:|...:|..||..: .:...|:|.||:|||
Human   242 KEEEPGA-----PSRGLGGSRTPLGEFICQLCKEQYADPFALAQHRCSR-IVRVEYRCPECDKVF 300

  Fly   368 VSPDHLAEHQASH-------------GAHNCPECGIRCDSKE--ALSKHMVQGHKRNLRNQCNIC 417
            ..|.:||.|:..|             .|...|.......|::  |::..:.:| |.|.|.:....
Human   301 SCPANLASHRRWHKPRPAAANAATVSSADGKPPSSSSSSSRDSGAIASFLAEG-KENSRIERTAD 364

  Fly   418 QKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNANLRQ--HKLRHSETKSFKCELCPHSFVTK 480
            |......|:..|.   |....|                ||  ..|.|.|..      .|....|:
Human   365 QHPQARDSSGADQ---HPDSAP----------------RQGLQVLTHPEPP------LPQGPYTE 404

  Fly   481 AEL---------TSHARTHTGDKPFECEVCLARFTTSCSLAKHKRKHT------------GER-- 522
            ..|         ||..|   |.:.|.|..|..:|.....|.||...|.            .||  
Human   405 GVLGRRVPVPGSTSGGR---GSEIFVCPYCHKKFRRQAYLRKHLSTHEAGSARALAPGFGSERGA 466

  Fly   523 --PYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCS----KTFTQRGDCQMHQRTHQGERIYI 581
              .:||.||...|...::.:.||..|......:.|..:    :|....|...     ...::|:.
Human   467 PLAFACPLCGAHFPTADIREKHRLWHAVREELLLPALAGAPPETSGPSGPSD-----GSAQQIFS 526

  Fly   582 CPVCNEEFKSMPEMRSHL 599
            |..|...|.|.|.:..|:
Human   527 CKHCPSTFFSSPGLTRHI 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 6/22 (27%)
COG5048 <357..570 CDD:227381 58/258 (22%)
C2H2 Zn finger 360..380 CDD:275368 10/19 (53%)
C2H2 Zn finger 385..406 CDD:275370 3/22 (14%)
C2H2 Zn finger 414..434 CDD:275368 3/19 (16%)
zf-H2C2_2 427..451 CDD:290200 3/23 (13%)
C2H2 Zn finger 442..490 CDD:275368 11/58 (19%)
C2H2 Zn finger 470..487 CDD:275368 5/25 (20%)
zf-H2C2_2 482..507 CDD:290200 9/33 (27%)
C2H2 Zn finger 498..518 CDD:275368 6/19 (32%)
zf-H2C2_2 510..534 CDD:290200 10/39 (26%)
C2H2 Zn finger 526..546 CDD:275368 6/19 (32%)
zf-H2C2_2 539..563 CDD:290200 5/27 (19%)
C2H2 Zn finger 554..574 CDD:275368 3/23 (13%)
C2H2 Zn finger 582..602 CDD:275368 6/18 (33%)
INSM2NP_115983.3 SNAG domain. /evidence=ECO:0000250 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..117
PdxA 140..>203 CDD:294567 9/25 (36%)
C2H2 Zn finger 265..285 CDD:275368 6/19 (32%)
zf-C2H2 291..313 CDD:278523 11/21 (52%)
C2H2 Zn finger 293..313 CDD:275368 10/19 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 310..418 22/133 (17%)
zf-C2H2 426..448 CDD:278523 7/21 (33%)
C2H2 Zn finger 428..448 CDD:275368 6/19 (32%)
C2H2 Zn finger 472..492 CDD:275368 6/19 (32%)
C2H2 Zn finger 527..548 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.