DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6654 and AT3G29340

DIOPT Version :9

Sequence 1:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_189580.1 Gene:AT3G29340 / 822592 AraportID:AT3G29340 Length:650 Species:Arabidopsis thaliana


Alignment Length:452 Identity:89/452 - (19%)
Similarity:127/452 - (28%) Gaps:206/452 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 CNAGFAVEKSLMIHRRQKGCINRNYKCNECEKVFVSPDHLAEHQASHGAHNCPECGIRCDSKEAL 398
            |:...|:..:|.        ...::||..|.|.|.....|..||..|.           ..||.|
plant    27 CSGVIALRSNLQ--------SKSSHKCKICGKSFECYQALGGHQRIHR-----------PIKEKL 72

  Fly   399 SKH---MVQGHKRNLRN---------QCNICQKVFTMLSTLRDHMRIH----------------- 434
            ||.   .|...|..|:.         :|.:|.|:|.....|..|.::|                 
plant    73 SKQEFSEVYPRKSKLQKRPESSSSCYECKVCGKIFGCYRGLGGHTKLHRSTKRELASTQDENSLL 137

  Fly   435 -----------------TGEKPFV--------------------------------------CNI 444
                             :.|:.|:                                      |.|
plant   138 DSSEAKKIVSQPSSFKVSQEEKFLHCVELKQDFSEPLSHSGALPSTLRSKLQTKTQWKSSCHCKI 202

  Fly   445 CGKSFTQNANLRQHKLRHSE---------------------TKSFKCELCPHSF-VTKAELTSHA 487
            |||||..:..|..||..|.|                     .|:.|....|.|| |::.|...|.
plant   203 CGKSFVCSQGLGNHKRVHREISGKLACKRKYTEDYNPFSDSLKAKKIVKKPSSFEVSQEEKILHC 267

  Fly   488 ----------RTHTG-DKPFECEVCLARFTTSCSLAKHKRKH-------------TGE---RPYA 525
                      ..|:| ||...|       :.|..:.|..||:             .||   |.:.
plant   268 VELKQDFGELLAHSGFDKSISC-------SKSIKVKKVARKNEKTEDSTSLFGVFVGEMSQRLHG 325

  Fly   526 CDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRTHQG---ERIY------- 580
            |..|..:|..|..:..|:|.|:|.                    |.|....   |||:       
plant   326 CKTCGRKFGTLKGVYGHQRMHSGN--------------------HNRIEDENGLERIWGLKKKSR 370

  Fly   581 ICPV-CNEEFKSMPEMRSHLAGHEQHD------------KRLVHFTFLSNKENGSGALEEEL 629
            :|.| ..:.||.    .|.:|..|:|:            :.:..|..:||...|.|.::.||
plant   371 VCSVSAFDRFKG----SSFMAEIEKHEVIEAALNLVMLCQGVYDFASISNLPLGDGFMDLEL 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 3/19 (16%)
COG5048 <357..570 CDD:227381 66/345 (19%)
C2H2 Zn finger 360..380 CDD:275368 7/19 (37%)
C2H2 Zn finger 385..406 CDD:275370 6/23 (26%)
C2H2 Zn finger 414..434 CDD:275368 6/19 (32%)
zf-H2C2_2 427..451 CDD:290200 12/95 (13%)
C2H2 Zn finger 442..490 CDD:275368 20/79 (25%)
C2H2 Zn finger 470..487 CDD:275368 5/17 (29%)
zf-H2C2_2 482..507 CDD:290200 7/35 (20%)
C2H2 Zn finger 498..518 CDD:275368 4/19 (21%)
zf-H2C2_2 510..534 CDD:290200 8/39 (21%)
C2H2 Zn finger 526..546 CDD:275368 6/19 (32%)
zf-H2C2_2 539..563 CDD:290200 4/23 (17%)
C2H2 Zn finger 554..574 CDD:275368 2/19 (11%)
C2H2 Zn finger 582..602 CDD:275368 6/20 (30%)
AT3G29340NP_189580.1 zf-C2H2_6 43..68 CDD:290623 9/35 (26%)
C2H2 Zn finger 45..65 CDD:275368 7/19 (37%)
C2H2 Zn finger 100..120 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.