DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6654 and ZNF134

DIOPT Version :9

Sequence 1:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_003426.3 Gene:ZNF134 / 7693 HGNCID:12918 Length:427 Species:Homo sapiens


Alignment Length:348 Identity:112/348 - (32%)
Similarity:156/348 - (44%) Gaps:35/348 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 VPQSAKRTSRRRGVVKQDVPATPPSDAEPSPKQHRLGTQRKLSAPRAGTVNGPSTTSGA---ATT 324
            :.|..:|......:||.   .|...:..||.|......::|         |..:|..|.   |..
Human   102 IEQPLRRDKSEASIVKN---CTVSKEPHPSEKPFTCKEEQK---------NFQATLGGCQQKAIH 154

  Fly   325 PELKYHCDRCNAGFAVEKSLMIHRRQKGCINRNYKCNECEKVFVSPDHLAEHQASHGA---HNCP 386
            .:.|.|       .:.|.....|..|     .:|||:||.|.|...|.|.:||..|..   :.|.
Human   155 SKRKTH-------RSTESGDAFHGEQ-----MHYKCSECGKAFSRKDTLVQHQRIHSGEKPYECS 207

  Fly   387 ECGIRCDSKEALSKHMVQGHKRNLRNQCNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQ 451
            |||.....|..|.:|. :.|......:|:.|.|.|:....|..|.||||||.|:.||.|||.|:.
Human   208 ECGKAFSRKATLVQHQ-RIHTGERPYECSECGKTFSRKDNLTQHKRIHTGEMPYKCNECGKYFSH 271

  Fly   452 NANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSLAKHKR 516
            ::||..|:..|:..:.:||..|...|..|:.|..|...|||:.|::|..|...|....:|.||:|
Human   272 HSNLIVHQRVHNGARPYKCSDCGKVFRHKSTLVQHESIHTGENPYDCSDCGKSFGHKYTLIKHQR 336

  Fly   517 KHTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRTHQGERIYI 581
            .||..:|:.|..|...|:..:....|:|.||||||:||..|.|.|.:......|||.|.|||.|.
Human   337 IHTESKPFECIECGKFFSRSSDYIAHQRVHTGERPFVCSKCGKDFIRTSHLVRHQRVHTGERPYE 401

  Fly   582 CPVCNEEFKSMPEMRSHLAGHEQ 604
            |..|.:.:    .:.|||..|::
Human   402 CSECGKAY----SLSSHLNRHQK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 3/22 (14%)
COG5048 <357..570 CDD:227381 80/215 (37%)
C2H2 Zn finger 360..380 CDD:275368 9/19 (47%)
C2H2 Zn finger 385..406 CDD:275370 7/20 (35%)
C2H2 Zn finger 414..434 CDD:275368 7/19 (37%)
zf-H2C2_2 427..451 CDD:290200 15/23 (65%)
C2H2 Zn finger 442..490 CDD:275368 17/47 (36%)
C2H2 Zn finger 470..487 CDD:275368 5/16 (31%)
zf-H2C2_2 482..507 CDD:290200 9/24 (38%)
C2H2 Zn finger 498..518 CDD:275368 7/19 (37%)
zf-H2C2_2 510..534 CDD:290200 9/23 (39%)
C2H2 Zn finger 526..546 CDD:275368 5/19 (26%)
zf-H2C2_2 539..563 CDD:290200 13/23 (57%)
C2H2 Zn finger 554..574 CDD:275368 7/19 (37%)
C2H2 Zn finger 582..602 CDD:275368 5/19 (26%)
ZNF134NP_003426.3 C2H2 Zn finger 178..198 CDD:275368 9/19 (47%)
COG5048 <202..358 CDD:227381 55/156 (35%)
C2H2 Zn finger 206..226 CDD:275368 7/20 (35%)
C2H2 Zn finger 234..254 CDD:275368 7/19 (37%)
C2H2 Zn finger 262..282 CDD:275368 9/19 (47%)
C2H2 Zn finger 290..310 CDD:275368 6/19 (32%)
C2H2 Zn finger 318..338 CDD:275368 7/19 (37%)
C2H2 Zn finger 346..366 CDD:275368 5/19 (26%)
C2H2 Zn finger 374..394 CDD:275368 7/19 (37%)
C2H2 Zn finger 402..422 CDD:275368 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.