DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6654 and ZNF16

DIOPT Version :9

Sequence 1:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001025147.2 Gene:ZNF16 / 7564 HGNCID:12947 Length:682 Species:Homo sapiens


Alignment Length:282 Identity:107/282 - (37%)
Similarity:149/282 - (52%) Gaps:5/282 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 TPELKYHCDRCNAGFAVEKSLMIHRRQKGCINRNYKCNECEKVFVSPDHLAEHQASHGA---HNC 385
            |.|..:.||.|...|: :.|::.:|.:.....:.|:|:||.|.|......:.||:.|.:   :.|
Human   232 TGEASFMCDDCGKTFS-QNSVLKNRHRSHMSEKAYQCSECGKAFRGHSDFSRHQSHHSSERPYMC 295

  Fly   386 PECGIRCDSKEALSKHMVQGHKRNLRNQCNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFT 450
            .|||.......:|.||. :.|......:||.|.|.|...|.|..|.|||:||||:||:.|||:|.
Human   296 NECGKAFSQNSSLKKHQ-KSHMSEKPYECNECGKAFRRSSNLIQHQRIHSGEKPYVCSECGKAFR 359

  Fly   451 QNANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSLAKHK 515
            :::||.:|...|:..|.|:|..|..:|...|.|..|.|.|||:||:||..|...|:...:|.||.
Human   360 RSSNLIKHHRTHTGEKPFECGECGKAFSQSAHLRKHQRVHTGEKPYECNDCGKPFSRVSNLIKHH 424

  Fly   516 RKHTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRTHQGERIY 580
            |.||||:||.|..|...|:..:.|..|||.||||:|:||..|.|.|:.....:.||..|.||:.|
Human   425 RVHTGEKPYKCSDCGKAFSQSSSLIQHRRIHTGEKPHVCNVCGKAFSYSSVLRKHQIIHTGEKPY 489

  Fly   581 ICPVCNEEFKSMPEMRSHLAGH 602
            .|.||.:.|.....:..|...|
Human   490 RCSVCGKAFSHSSALIQHQGVH 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 6/22 (27%)
COG5048 <357..570 CDD:227381 87/215 (40%)
C2H2 Zn finger 360..380 CDD:275368 7/19 (37%)
C2H2 Zn finger 385..406 CDD:275370 7/20 (35%)
C2H2 Zn finger 414..434 CDD:275368 9/19 (47%)
zf-H2C2_2 427..451 CDD:290200 15/23 (65%)
C2H2 Zn finger 442..490 CDD:275368 18/47 (38%)
C2H2 Zn finger 470..487 CDD:275368 5/16 (31%)
zf-H2C2_2 482..507 CDD:290200 12/24 (50%)
C2H2 Zn finger 498..518 CDD:275368 7/19 (37%)
zf-H2C2_2 510..534 CDD:290200 12/23 (52%)
C2H2 Zn finger 526..546 CDD:275368 7/19 (37%)
zf-H2C2_2 539..563 CDD:290200 14/23 (61%)
C2H2 Zn finger 554..574 CDD:275368 6/19 (32%)
C2H2 Zn finger 582..602 CDD:275368 5/19 (26%)
ZNF16NP_001025147.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Necessary for transcription activation 62..210
COG5048 <160..369 CDD:227381 49/138 (36%)
C2H2 Zn finger 187..203 CDD:275368
C2H2 Zn finger 211..231 CDD:275368
C2H2 Zn finger 239..259 CDD:275368 6/20 (30%)
C2H2 Zn finger 267..287 CDD:275368 7/19 (37%)
Required for nuclear localization 268..393 46/125 (37%)
C2H2 Zn finger 295..315 CDD:275368 7/20 (35%)
COG5048 303..675 CDD:227381 86/210 (41%)
C2H2 Zn finger 323..343 CDD:275368 9/19 (47%)
Required for nuclear localization 341..373 17/31 (55%)
C2H2 Zn finger 351..371 CDD:275368 8/19 (42%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
C2H2 Zn finger 407..427 CDD:275368 7/19 (37%)
C2H2 Zn finger 435..455 CDD:275368 7/19 (37%)
C2H2 Zn finger 463..483 CDD:275368 6/19 (32%)
Required for nuclear localization 473..503 10/29 (34%)
C2H2 Zn finger 491..511 CDD:275368 5/19 (26%)
C2H2 Zn finger 519..539 CDD:275368
C2H2 Zn finger 547..567 CDD:275368
C2H2 Zn finger 575..595 CDD:275368
C2H2 Zn finger 603..623 CDD:275368
C2H2 Zn finger 631..651 CDD:275368
C2H2 Zn finger 659..679 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.