DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6654 and GZF1

DIOPT Version :9

Sequence 1:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001303941.1 Gene:GZF1 / 64412 HGNCID:15808 Length:711 Species:Homo sapiens


Alignment Length:622 Identity:185/622 - (29%)
Similarity:250/622 - (40%) Gaps:123/622 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KIKCENSSRTLRQLLPNALPEEPDSKVSISCPVATTDQAVQTTSWEPDRCTASVQTDAVTTTDAE 130
            |:||.:.|.|..||....|     ..|.:.....:..|.|:.:|  ..:.:|:....|...||..
Human   115 KLKCLDLSETCFQLKKQML-----ESVLLELQNFSESQEVEVSS--GSQVSAAPAPRASVATDGP 172

  Fly   131 QNTSLIKSTISVDLDYEGE--GEVFDYELP-----------DEPVEKTTSLILQVQGNLKDEKEV 182
            ..:.|..|     |||.||  ......:||           .|.|:.....|.:..|.|...|..
Human   173 HPSGLTDS-----LDYPGERASNGMSSDLPPKKSKDKLDKKKEVVKPPYPKIRRASGRLAGRKVF 232

  Fly   183 V----------FTQTNVIYEGD--DHELEQQIRECNLAIFEGVDNEAEIITVTAPQVTTRKSAAK 235
            |          ..:.....|||  |:...|             |...:.:.....||:..:....
Human   233 VEIPKKKYTRRLREQQKTAEGDVGDYRCPQ-------------DQSPDRVGTEMEQVSKNEGCQA 284

  Fly   236 LLTQQENDKHQTPVGSKEEARELEKEQVPQSAKRTSRRRGVVKQDVPATPPSDAEPSPKQHRLGT 300
            ....:|..|...|     |..|.|:|:..:..|:.|..:..:.:.......|..:.|..:|    
Human   285 GAELEELSKKAGP-----EEEEEEEEEDEEGEKKKSNFKCSICEKAFLYEKSFLKHSKHRH---- 340

  Fly   301 QRKLSAPRAGTVNGPSTTSGAATTPELKYHCDRCNAGFAVEKSLMIHRRQKGCINRNYKCNECEK 365
                               |.||  |:.|.||.|...||...:|..|:|......|::.|..|.|
Human   341 -------------------GVAT--EVVYRCDTCGQTFANRCNLKSHQRHVHSSERHFPCELCGK 384

  Fly   366 VF-----VSPDHLAEHQASHGAHNCPECGIRCDSKEALSKHMVQGHKRNLRNQCNICQKVFTMLS 425
            .|     |....|..|:.....|.|.:||....||.||..| .:.|..:....|..|...|:..|
Human   385 KFKRKKDVKRHVLQVHEGGGERHRCGQCGKGLSSKTALRLH-ERTHTGDRPYGCTECGARFSQPS 448

  Fly   426 TLRDHMRIHTGEKPFVCNICGKSFTQNANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHARTH 490
            .|:.|||||||||||||:.||..||||..|..||..|:..:.|.||.|..||.:|..|..|.|.|
Human   449 ALKTHMRIHTGEKPFVCDECGARFTQNHMLIYHKRCHTGERPFMCETCGKSFASKEYLKHHNRIH 513

  Fly   491 TGDKPFECEVCLARFTTSCSLAKHKRKHTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCP 555
            ||.|||:||||...|....||.:|.:.|||||||.||.|..:||.||.|:.|||.||||||::|.
Human   514 TGSKPFKCEVCFRTFAQRNSLYQHIKVHTGERPYCCDQCGKQFTQLNALQRHRRIHTGERPFMCN 578

  Fly   556 FCSKTFTQRGDCQMHQRTHQGERIYICPVCNEEFKSMPEMRSHLA----------GH--EQHDKR 608
            .|.:|||.:...:.|...|.              |:.| .:|.|.          ||  ||.|:.
Human   579 ACGRTFTDKSTLRRHTSIHD--------------KNTP-WKSFLVIVDGSPKNDDGHKTEQPDEE 628

  Fly   609 LVHFTFLSNK-----ENGS----GALEEELNEMTESA 636
            .|. :.||:|     |||.    .|:::.:..|.|::
Human   629 YVS-SKLSDKLLSFAENGHFHNLAAVQDTVPTMQENS 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071 5/12 (42%)
C2H2 Zn finger 331..354 CDD:275368 8/22 (36%)
COG5048 <357..570 CDD:227381 98/217 (45%)
C2H2 Zn finger 360..380 CDD:275368 7/24 (29%)
C2H2 Zn finger 385..406 CDD:275370 8/20 (40%)
C2H2 Zn finger 414..434 CDD:275368 8/19 (42%)
zf-H2C2_2 427..451 CDD:290200 17/23 (74%)
C2H2 Zn finger 442..490 CDD:275368 21/47 (45%)
C2H2 Zn finger 470..487 CDD:275368 7/16 (44%)
zf-H2C2_2 482..507 CDD:290200 14/24 (58%)
C2H2 Zn finger 498..518 CDD:275368 8/19 (42%)
zf-H2C2_2 510..534 CDD:290200 13/23 (57%)
C2H2 Zn finger 526..546 CDD:275368 11/19 (58%)
zf-H2C2_2 539..563 CDD:290200 14/23 (61%)
C2H2 Zn finger 554..574 CDD:275368 6/19 (32%)
C2H2 Zn finger 582..602 CDD:275368 4/29 (14%)
GZF1NP_001303941.1 BTB 21..133 CDD:306997 7/17 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..220 16/73 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..312 15/86 (17%)
C2H2 Zn finger 319..339 CDD:275368 2/19 (11%)
C2H2 Zn finger 350..371 CDD:275368 8/20 (40%)
COG5048 <405..593 CDD:227381 91/188 (48%)
C2H2 Zn finger 409..429 CDD:275368 8/20 (40%)
C2H2 Zn finger 437..457 CDD:275368 8/19 (42%)
C2H2 Zn finger 465..485 CDD:275368 10/19 (53%)
C2H2 Zn finger 493..513 CDD:275368 9/19 (47%)
C2H2 Zn finger 521..541 CDD:275368 8/19 (42%)
C2H2 Zn finger 549..569 CDD:275368 11/19 (58%)
C2H2 Zn finger 577..597 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.