DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6654 and Zbtb32

DIOPT Version :9

Sequence 1:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_067372.2 Gene:Zbtb32 / 58206 MGIID:1891838 Length:465 Species:Mus musculus


Alignment Length:117 Identity:40/117 - (34%)
Similarity:54/117 - (46%) Gaps:10/117 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   463 SETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSLAKHKRKHTGERPYACD 527
            |:.::..|....|     ..|.|.||:    :|:.|.||..||:....:..|.|.||||:|::|.
Mouse   326 SQERTLNCPSHQH-----PPLPSPARS----RPYSCSVCGKRFSLKHQMETHYRVHTGEKPFSCS 381

  Fly   528 LCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRTHQGERI 579
            |||.|....:.:..|.||| |..||.||.|..........|.|.|.|...|:
Mouse   382 LCPQRSRDFSAMTKHLRTH-GAAPYRCPLCRAGCPSLASMQAHMRGHSPSRL 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368
COG5048 <357..570 CDD:227381 36/106 (34%)
C2H2 Zn finger 360..380 CDD:275368
C2H2 Zn finger 385..406 CDD:275370
C2H2 Zn finger 414..434 CDD:275368
zf-H2C2_2 427..451 CDD:290200
C2H2 Zn finger 442..490 CDD:275368 7/26 (27%)
C2H2 Zn finger 470..487 CDD:275368 4/16 (25%)
zf-H2C2_2 482..507 CDD:290200 10/24 (42%)
C2H2 Zn finger 498..518 CDD:275368 7/19 (37%)
zf-H2C2_2 510..534 CDD:290200 12/23 (52%)
C2H2 Zn finger 526..546 CDD:275368 7/19 (37%)
zf-H2C2_2 539..563 CDD:290200 10/23 (43%)
C2H2 Zn finger 554..574 CDD:275368 6/19 (32%)
C2H2 Zn finger 582..602 CDD:275368
Zbtb32NP_067372.2 BTB_POZ 13..114 CDD:365784
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..179
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..310
zf-C2H2 350..372 CDD:333835 7/21 (33%)
C2H2 Zn finger 352..372 CDD:275368 7/19 (37%)
zf-H2C2_2 365..386 CDD:372612 11/20 (55%)
C2H2 Zn finger 380..400 CDD:275368 7/19 (37%)
C2H2 Zn finger 407..427 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.