DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6654 and CG14667

DIOPT Version :9

Sequence 1:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster


Alignment Length:519 Identity:104/519 - (20%)
Similarity:161/519 - (31%) Gaps:206/519 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DVDKICLTCLSSTGPLLSIYDGGSGSCLADMIREFTKTKPRRNDNLPEKVCLSCLSEISNCYTFK 66
            ||.:||...:.......:|:....|..|. .::..|..:..||..|||.||..|.||:.....|:
  Fly     5 DVCRICANKIMGHQRDRNIFIHMRGKYLG-QLKLITGVELTRNQGLPEIVCERCFSELDLATKFR 68

  Fly    67 IKCENSSRTLRQLLPNALPEEPDSKVSISCPVATTDQAVQTTSWEPDRCTASVQTDAVTTTDAEQ 131
            .:|..|.:.|..::..                 |:||                            
  Fly    69 ERCIFSQKYLLDIIKK-----------------TSDQ---------------------------- 88

  Fly   132 NTSLIKSTISVDLDYEGEGEVFDYELPDEPVEKTTSLILQVQGNLKDEKEVVFTQTNVIYEGDDH 196
                  ||:.|             ||..||:::......|::.:..|::       .|.|:|...
  Fly    89 ------STVHV-------------ELSSEPLDEQLIDADQLETHYDDDQ-------YVCYQGTKE 127

  Fly   197 ELEQQIRECNLAIFEGVDNEAEIITVTAPQVTTRKSAAKLLTQQENDKHQTPVGSKEEARELEKE 261
            | .|.:.|..|      |::.....:.|.:      ||....|||               :|:::
  Fly   128 E-HQDLEEIEL------DDDPSAAVIAAAE------AAAEAAQQE---------------DLQEQ 164

  Fly   262 QVPQSAKRTSRRRGVVKQDVPATPPSDAEPSPKQHRLGTQRKLSAPRAGTVNGPSTTSGAATTPE 326
            ::.::|||.|.                                                      
  Fly   165 EMERAAKRRSN------------------------------------------------------ 175

  Fly   327 LKYHCDRCNAGFAVEKSLMIHRRQKGCINRNYKCNECEKVFVSPDHLAEHQASHGAHN---CPEC 388
             .:.||.|...|                         ...|:..:||..||.....:.   ||||
  Fly   176 -FFICDECGTLF-------------------------HDAFLYTEHLNGHQNRRDMNQFFPCPEC 214

  Fly   389 GIRCDSKEALSKHMVQGHKRNLRNQCNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNA 453
            ....:.|..|.:|..|.|..|.|.||.||.:.|..|.....|.:.|..|:|:.|..||..|:..:
  Fly   215 PQTFNKKALLKQHRTQVHLINRRFQCTICHEAFASLGAKLRHDKAHKNERPYPCLECGMIFSSVS 279

  Fly   454 NLRQHKLRHS-ETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSLAKHKR 516
            .|:.|...|| :.:.|:||.|...|:|:..|.:|.:|                      |.|||
  Fly   280 ELQNHFSTHSKQIRKFRCEPCNMDFITRRGLVAHTKT----------------------APHKR 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071 20/72 (28%)
C2H2 Zn finger 331..354 CDD:275368 4/22 (18%)
COG5048 <357..570 CDD:227381 47/164 (29%)
C2H2 Zn finger 360..380 CDD:275368 5/19 (26%)
C2H2 Zn finger 385..406 CDD:275370 8/20 (40%)
C2H2 Zn finger 414..434 CDD:275368 6/19 (32%)
zf-H2C2_2 427..451 CDD:290200 8/23 (35%)
C2H2 Zn finger 442..490 CDD:275368 16/48 (33%)
C2H2 Zn finger 470..487 CDD:275368 6/16 (38%)
zf-H2C2_2 482..507 CDD:290200 3/24 (13%)
C2H2 Zn finger 498..518 CDD:275368 4/19 (21%)
zf-H2C2_2 510..534 CDD:290200 4/7 (57%)
C2H2 Zn finger 526..546 CDD:275368
zf-H2C2_2 539..563 CDD:290200
C2H2 Zn finger 554..574 CDD:275368
C2H2 Zn finger 582..602 CDD:275368
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 21/74 (28%)
C2H2 Zn finger 179..199 CDD:275368 7/44 (16%)
C2H2 Zn finger 211..232 CDD:275368 8/20 (40%)
C2H2 Zn finger 240..260 CDD:275368 6/19 (32%)
zf-C2H2_8 243..313 CDD:292531 22/69 (32%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
C2H2 Zn finger 297..316 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.