DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6654 and zgc:76872

DIOPT Version :9

Sequence 1:	NP_650429.1	Gene:	CG6654 / 41831	FlyBaseID:	FBgn0038301	Length:	639	Species:	Drosophila melanogaster
Sequence 2:	NP_991269.1	Gene:	zgc:76872 / 403007	ZFINID:	ZDB-GENE-040426-1794	Length:	588	Species:	Danio rerio

Alignment Length:	132	Identity:	48/132 - (36%)
Similarity:	61/132 - (46%)	Gaps:	10/132 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   444 ICGKSFTQNANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTS 508
            |.|.|||...         ||| ||.|..|..|..::...:.|...|:|.||.:|.:|...|:..
Zfish   443 IAGPSFTPTG---------SET-SFDCSHCGKSLRSRKNYSKHMFIHSGQKPHQCSICWRSFSLR 497

  Fly   509 CSLAKHKRKHTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRT 573
            ..|.||...|||.|.:.|.:|..|||..:.|..|.|||..||.:.|..|.:.||.|...:.|...
Zfish   498 DYLLKHMVVHTGVRAFQCSVCSKRFTQKSSLNVHMRTHRVERTFTCAVCHRAFTHRTLLERHALQ 562

  Fly   574 HQ 575
            ||
Zfish   563 HQ 564

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6654	NP_650429.1	zf-AD	6..79	CDD:285071
		C2H2 Zn finger	331..354	CDD:275368
		COG5048	<357..570	CDD:227381	45/125 (36%)
		C2H2 Zn finger	360..380	CDD:275368
		C2H2 Zn finger	385..406	CDD:275370
		C2H2 Zn finger	414..434	CDD:275368
		zf-H2C2_2	427..451	CDD:290200	4/6 (67%)
		C2H2 Zn finger	442..490	CDD:275368	14/45 (31%)
		C2H2 Zn finger	470..487	CDD:275368	3/16 (19%)
		zf-H2C2_2	482..507	CDD:290200	8/24 (33%)
		C2H2 Zn finger	498..518	CDD:275368	6/19 (32%)
		zf-H2C2_2	510..534	CDD:290200	10/23 (43%)
		C2H2 Zn finger	526..546	CDD:275368	8/19 (42%)
		zf-H2C2_2	539..563	CDD:290200	10/23 (43%)
		C2H2 Zn finger	554..574	CDD:275368	6/19 (32%)
		C2H2 Zn finger	582..602	CDD:275368
zgc:76872	NP_991269.1	BTB	24..123	CDD:279045
		BTB	35..127	CDD:197585
		COG5048	<446..>526	CDD:227381	31/89 (35%)
		C2H2 Zn finger	459..479	CDD:275368	4/19 (21%)
		zf-H2C2_2	471..495	CDD:290200	7/23 (30%)
		C2H2 Zn finger	487..507	CDD:275368	6/19 (32%)
		zf-H2C2_2	499..524	CDD:290200	11/24 (46%)
		zf-C2H2	513..535	CDD:278523	8/21 (38%)
		C2H2 Zn finger	515..535	CDD:275368	8/19 (42%)
		zf-H2C2_2	527..552	CDD:290200	10/24 (42%)
		C2H2 Zn finger	543..565	CDD:275368	8/22 (36%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	0	0.000