DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6654 and CG17359

DIOPT Version :9

Sequence 1:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster


Alignment Length:560 Identity:117/560 - (20%)
Similarity:165/560 - (29%) Gaps:244/560 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDVDKICLTCLSSTGPLLSIYDGGSGS---------CLADMIREFTKTKPRRNDNLPEKVCLSCL 56
            ||:.::|..|...:..||.||.....|         .||.|:||.:.....:.|.:|:.:|:.|.
  Fly     1 MDISQMCRVCRDESDCLLDIYTEPYASSNRVQEQEPVLATMLRECSGCSVHKEDGMPQFICVECA 65

  Fly    57 SEISNCYTFKIKCENSSRTLRQLLPNALPEEPDSKVSISCPVATTDQAVQTTSWEPDRCTASVQT 121
            ..:.|.|..:.:|..|.:...||  ..:.:|.|                                
  Fly    66 EAVRNAYRLRRQCRKSHQYFEQL--RLMMKELD-------------------------------- 96

  Fly   122 DAVTTTDAEQNTSLIKSTISVDLDYEGEGEVFDYELPDEPVEKTTSLILQVQGNLKDEKEVVFTQ 186
                                 |::|                      .|.:..|::.:..|    
  Fly    97 ---------------------DIEY----------------------CLNIGDNIEPQMPV---- 114

  Fly   187 TNVIYEGDDHELEQQIRECNLAIFEGVDNEAEIITVTAPQVTTRKSAAKLLTQQENDKHQTPVGS 251
             :|:..|                                  .|.:::..||.:....|:..|   
  Fly   115 -SVMEAG----------------------------------KTPETSEPLLVELVQVKYMPP--- 141

  Fly   252 KEEARELEKEQVPQSAKRTSRRRGVVKQDVPATPPSDAEPSPKQHRLGTQRKLSAPRAGTVNGPS 316
                                          ...|.|...|...:|:|                 :
  Fly   142 ------------------------------EPKPISSPLPDNNEHKL-----------------A 159

  Fly   317 TTSGAATTPELKYHCDRCNAGFAVEKSLMIHRRQKGCINRNYKCNECEKVFVSPDHLAEHQASHG 381
            .:...|.||                     |.:.|... |:|..|:.    .|||...||:....
  Fly   160 QSYSPAKTP---------------------HNKSKRRA-RSYSDNDS----WSPDSELEHEDDDK 198

  Fly   382 AHNCPECGIRCDSKEALSKHMVQGHKRNLRNQCNICQKVFTMLSTLRDHMRIHTGEKPFVCNICG 446
            ..|.        ||....|. |.|..|     |.:|.:.||....|..||||||||:|       
  Fly   199 IWNA--------SKRGKPKR-VPGPYR-----CKLCTQSFTQKQNLEIHMRIHTGERP------- 242

  Fly   447 KSFTQNANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSL 511
                                 :||.|||.||..|..|.||.|.|||::||.|..|..||.....|
  Fly   243 ---------------------YKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQL 286

  Fly   512 AKHKRKHTGERPYACDLCPMRFTALNVLKNHRRTHT-GER 550
            ..|.|.||||:|:.|..|...|..||.|:.|...|| |:|
  Fly   287 QVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGKR 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071 20/81 (25%)
C2H2 Zn finger 331..354 CDD:275368 2/22 (9%)
COG5048 <357..570 CDD:227381 68/195 (35%)
C2H2 Zn finger 360..380 CDD:275368 6/19 (32%)
C2H2 Zn finger 385..406 CDD:275370 4/20 (20%)
C2H2 Zn finger 414..434 CDD:275368 8/19 (42%)
zf-H2C2_2 427..451 CDD:290200 10/23 (43%)
C2H2 Zn finger 442..490 CDD:275368 12/47 (26%)
C2H2 Zn finger 470..487 CDD:275368 9/16 (56%)
zf-H2C2_2 482..507 CDD:290200 13/24 (54%)
C2H2 Zn finger 498..518 CDD:275368 7/19 (37%)
zf-H2C2_2 510..534 CDD:290200 10/23 (43%)
C2H2 Zn finger 526..546 CDD:275368 7/19 (37%)
zf-H2C2_2 539..563 CDD:290200 6/13 (46%)
C2H2 Zn finger 554..574 CDD:275368
C2H2 Zn finger 582..602 CDD:275368
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 20/81 (25%)
zf-C2H2 215..237 CDD:278523 9/26 (35%)
C2H2 Zn finger 217..237 CDD:275368 8/19 (42%)
zf-H2C2_2 229..254 CDD:290200 17/52 (33%)
C2H2 Zn finger 245..265 CDD:275368 11/19 (58%)
zf-H2C2_2 257..282 CDD:290200 13/24 (54%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 286..310 CDD:290200 11/23 (48%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.