DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6654 and Zbtb6

DIOPT Version :9

Sequence 1:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001102423.1 Gene:Zbtb6 / 366029 RGDID:1306007 Length:423 Species:Rattus norvegicus


Alignment Length:468 Identity:100/468 - (21%)
Similarity:158/468 - (33%) Gaps:146/468 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 EGEVFDYELPDEPVEKTTSLILQVQGNLKDEKEVVFTQTNVIYEGD------------------D 195
            |.||..::.     |:...::||....|:.:.  :|...: ||..|                  |
  Rat     4 ESEVLHFQF-----EQQGDVVLQKMNLLRQQN--LFCDVS-IYINDTEFQGHKVILAACSTFMRD 60

  Fly   196 HELEQQIRECNLAIFEGVDNEAEII--TVTAPQVTTRKSAAKLLT-------------------- 238
            ..|..|.:...:.|.:..:...:::  ..|......||...|.||                    
  Rat    61 QFLLTQSKHIRITILQSAEVGRKLLLSCYTGALEVKRKELLKYLTAASYLQMVHIVEKCTEALSK 125

  Fly   239 ------QQENDKH-------QTPVGSKEEARELEKEQVPQSAKRTSRRRGVVKQDVPAT--PP-- 286
                  ..:|::|       .|.|.::||..:.:.|.:.            :.:|.|..  ||  
  Rat   126 YLEIDLSMKNNQHTDLCQSSDTDVKNEEENSDKDCEIIE------------ISEDSPVNLDPPVK 178

  Fly   287 ---SDAEPSPKQHRLGTQRKLSAPRAGTVNG------------PSTTSGAATTPELKYHCDRCNA 336
               .||..|..:.....:|.:.:|...||:|            .|..:......:....|...||
  Rat   179 EEEGDALQSAAETLTSERRGVKSPELSTVDGGFKENEICILHVESIHTDDIENGQFPQPCTSSNA 243

  Fly   337 GFAVEKSLMIHRRQKGCINRNYKCNECEKVFVSPDHLAEHQASHGAHNCPECGIRCDSKEALSKH 401
            |      :.....|...||...: |...:|..:.:.....:.|.|:|.              :.:
  Rat   244 G------MYFPETQHSVINSTVE-NRVTEVPGNTNQGLFSENSDGSHG--------------TIN 287

  Fly   402 MVQGHKRN--LRNQCNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNANLRQHKLRHSE 464
            .:|....|  ||:||..|.:.|..:.....|:::|   |.|:|..|||:|||..||.:       
  Rat   288 EIQNLDENFSLRHQCPRCPRGFLHVENYLRHLKMH---KLFLCLQCGKTFTQKKNLNR------- 342

  Fly   465 TKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSLAKHKRKHTGERPYACDLC 529
                                 |.|.|.|.:||:|.|||..||...:|..|...|:|:|||.|..|
  Rat   343 ---------------------HIRGHMGIRPFQCTVCLKTFTAKSTLQDHLNIHSGDRPYKCHCC 386

  Fly   530 PMRFTALNVLKNH 542
            .|.|...:.||.|
  Rat   387 DMDFKHKSALKKH 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 5/22 (23%)
COG5048 <357..570 CDD:227381 52/188 (28%)
C2H2 Zn finger 360..380 CDD:275368 2/19 (11%)
C2H2 Zn finger 385..406 CDD:275370 1/20 (5%)
C2H2 Zn finger 414..434 CDD:275368 4/19 (21%)
zf-H2C2_2 427..451 CDD:290200 9/23 (39%)
C2H2 Zn finger 442..490 CDD:275368 11/47 (23%)
C2H2 Zn finger 470..487 CDD:275368 0/16 (0%)
zf-H2C2_2 482..507 CDD:290200 11/24 (46%)
C2H2 Zn finger 498..518 CDD:275368 8/19 (42%)
zf-H2C2_2 510..534 CDD:290200 10/23 (43%)
C2H2 Zn finger 526..546 CDD:275368 7/17 (41%)
zf-H2C2_2 539..563 CDD:290200 3/4 (75%)
C2H2 Zn finger 554..574 CDD:275368
C2H2 Zn finger 582..602 CDD:275368
Zbtb6NP_001102423.1 BTB_POZ_ZBTB6 8..123 CDD:349506 18/122 (15%)
COG5048 <251..>398 CDD:227381 53/192 (28%)
C2H2 Zn finger 302..322 CDD:275368 4/19 (21%)
zf-C2H2 325..347 CDD:395048 12/49 (24%)
C2H2 Zn finger 327..347 CDD:275368 11/47 (23%)
zf-H2C2_2 339..363 CDD:404364 12/51 (24%)
C2H2 Zn finger 355..375 CDD:275368 8/19 (42%)
C2H2 Zn finger 383..400 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.