DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6654 and ZNF429

DIOPT Version :9

Sequence 1:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_016882237.1 Gene:ZNF429 / 353088 HGNCID:20817 Length:689 Species:Homo sapiens


Alignment Length:547 Identity:156/547 - (28%)
Similarity:236/547 - (43%) Gaps:73/547 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 SKVSISCPVATTDQAVQTTSWEPDRCTASVQTDAVTTTDAEQNTSLIKSTISVD-------LDYE 147
            |..::..|:..||.|:: .|.|..:|..:.|.:.......|...:|:...|:|.       |:.|
Human    11 STFALKGPLTFTDVAIE-FSLEEWQCLDTAQQNLYRNVMLENYRNLVFLGIAVSKPDLITCLEKE 74

  Fly   148 GEG-EVFDYELPDEPVEKTTSLI--LQVQGNLKDEKEVVFTQTNVIYEGDDHELEQQIR------ 203
            .|. ::..:|:.|||....:...  ...:.::||..:.|..:.   |:...|| ..|:|      
Human    75 KEPCKMKRHEMVDEPPVVCSHFAEDFWPEQDIKDSFQKVTLRR---YDKRGHE-NLQLRKGYKTV 135

  Fly   204 -ECNLAIFEGVDNEA-EIITVTAPQVTTRKSAAKLLTQQEN-DKHQTPVGSKEEARELEKEQVPQ 265
             :|.|  ::|..|.. :.:|:|..::.......|:.....| |:::|....|:          |.
Human   136 GDCKL--YKGGYNGLNQCLTLTQSKMYHCDIYVKVFYAFSNADRYKTRHTGKK----------PF 188

  Fly   266 SAKRTSRRRGVVKQDVPATPPSDAEPSPKQHRLGTQRKLSAPRAGTVN----GPSTTSGAATT-- 324
            ..|:..:...::.|                   .||.|....|..|..    |.:....:|.|  
Human   189 QCKKCGKSFCMLSQ-------------------LTQHKKIHIRENTYRCKEFGNAFNQSSALTNH 234

  Fly   325 -----PELKYHCDRCNAGFAVEKSLMIHRR-QKGCINRNYKCNECEKVFVSPDHLAEHQASHGA- 382
                 .|..|.|:.|...|....:|..|:| ..|  .:.|||.||.|.|.....|..|:..|.. 
Human   235 KRIYVGEKHYRCEECGKAFNHYSTLTNHKRIHTG--EKPYKCKECGKAFSRYSTLTTHKRIHSGE 297

  Fly   383 --HNCPECGIRCDSKEALSKHMVQGHKRNLRNQCNICQKVFTMLSTLRDHMRIHTGEKPFVCNIC 445
              :.|.|||.........:||.:. |......:|..|.|.|...|||..|.||||||||:.|..|
Human   298 KPYKCDECGKTFSISSTFTKHKII-HTEEKPYKCKECGKAFNRSSTLTSHKRIHTGEKPYKCEEC 361

  Fly   446 GKSFTQNANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCS 510
            ||:|..::.|.:||:.|:..|.:|||.|..:|...:.||.|.:.|||::|::.|.|...||.|.:
Human   362 GKAFNWSSTLTKHKVIHTGEKPYKCEECGKAFNQSSRLTRHKKIHTGEEPYKFEKCGRVFTCSST 426

  Fly   511 LAKHKRKHTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRTHQ 575
            |.:.|:.||||:||.|:.|...||..:.|..|:|.||.|:||.|..|.|.|.:......|:|.|.
Human   427 LTQDKKIHTGEKPYNCEECGKVFTYSSTLTRHKRIHTEEKPYKCNECGKAFNRSSHLTSHRRIHT 491

  Fly   576 GERIYICPVCNEEFKSMPEMRSHLAGH 602
            ||:.|.|..|.:.||....:.||...|
Human   492 GEKPYKCEECGKAFKQSSNLNSHKKIH 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 7/23 (30%)
COG5048 <357..570 CDD:227381 84/215 (39%)
C2H2 Zn finger 360..380 CDD:275368 7/19 (37%)
C2H2 Zn finger 385..406 CDD:275370 6/20 (30%)
C2H2 Zn finger 414..434 CDD:275368 9/19 (47%)
zf-H2C2_2 427..451 CDD:290200 15/23 (65%)
C2H2 Zn finger 442..490 CDD:275368 18/47 (38%)
C2H2 Zn finger 470..487 CDD:275368 6/16 (38%)
zf-H2C2_2 482..507 CDD:290200 10/24 (42%)
C2H2 Zn finger 498..518 CDD:275368 7/19 (37%)
zf-H2C2_2 510..534 CDD:290200 10/23 (43%)
C2H2 Zn finger 526..546 CDD:275368 7/19 (37%)
zf-H2C2_2 539..563 CDD:290200 12/23 (52%)
C2H2 Zn finger 554..574 CDD:275368 6/19 (32%)
C2H2 Zn finger 582..602 CDD:275368 6/19 (32%)
ZNF429XP_016882237.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.