DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6654 and CG11695

DIOPT Version :9

Sequence 1:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster


Alignment Length:640 Identity:147/640 - (22%)
Similarity:218/640 - (34%) Gaps:178/640 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ICLTCLSSTGPLLSIYD-GGSG-----SCLADMIREFTKTKPRRNDNLPEKVCLSCLSEISNCYT 64
            ||..||......:.|:| ..||     |.||::|.:..:.....||.:.:.:|..|..::::...
  Fly     2 ICRLCLDDAEHSVPIFDQDDSGDQPVPSNLAELIEKHLQLVLLPNDGVSKSLCTQCWQQLADFEQ 66

  Fly    65 FKIKCENSSRTLRQLL--PNALPEEPDSKVSISCPVATTDQAVQTTSWEP--DRCTASVQTDAVT 125
            |..........|:||.  |.:..|:.|:|..|.|              ||  |...|:...:...
  Fly    67 FCAMVMKKQLGLQQLKMEPFSEDEDADTKAQILC--------------EPEIDVSPAAADNEECN 117

  Fly   126 TTDAEQNTSLIKSTISVDLDYEGEGEVFDYELPDEPVEKTTSLILQVQGNLKDEKEVVFTQTNVI 190
            ..|.:.:::...|:|                       :||||           :|:        
  Fly   118 EIDGDASSNSRSSSI-----------------------RTTSL-----------REM-------- 140

  Fly   191 YEGDDHELEQQIRECNLAIFEGVDNEAEIITVTAPQVTTRKSAAKLLTQQENDKHQTPVGSKEEA 255
                  .|...||. .:.:..         .||||:....|:.|:..|      |:......|:|
  Fly   141 ------RLPSPIRR-RMRLPR---------AVTAPKTQAVKAKARTKT------HKAEADEDEDA 183

  Fly   256 RELEKEQVPQSAKRTSRRRGVVKQDVPATPPSDAEPSPKQHRLGTQRKLSAPRAGTVNGPSTTSG 320
               |.|..|:|....||.                    ....:....:|.....|         |
  Fly   184 ---EGEGDPESRSSNSRE--------------------MDSYIALHGRLECCICG---------G 216

  Fly   321 AATTP---ELKYHCDRCNAGFAVEKSLMIHRRQKG---CINRNYKCNECEKVFVSPDHLAEHQAS 379
            ....|   |:|.|             ...|.:..|   |..|.||     |..:..|||  |.  
  Fly   217 DEQFPNFAEMKRH-------------FRNHHQSLGYVVCCQRRYK-----KRALYVDHL--HM-- 259

  Fly   380 HGAHNCPECGIRCD--SKEALSK-----HMVQGH--KRNLRNQCNICQKVFTMLSTLRDHMRIHT 435
               ||.|.. .||.  ||:.:|:     ||::.|  |.:|...|:.|.|.|:....|..|.|:|.
  Fly   260 ---HNDPNY-FRCKICSKQLVSRISYDVHMLRFHPNKDDLSFACDQCSKRFSKQFLLTIHSRVHQ 320

  Fly   436 GEKPFVCNICGKSFTQNANLRQHKLRHSETK--SFKCELCPHSFVTKAELTSHART--HTGDK-- 494
            .|:...|..|.:||....:||.|..|..:..  .|.|:.|...|.||..|..|.||  ..|.:  
  Fly   321 QERNEQCKHCDRSFRTAVDLRLHMRRTHDPAFVPFICDSCGAKFKTKQNLLVHKRTVHREGSQLP 385

  Fly   495 PFECEVCLARFTTSCSLAKHKRKH---TGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPF 556
            ..:|:.|....:...||.||...|   ...|.:.|:.|.:...:...|..|.|.|..:..:.|..
  Fly   386 EVQCQECQVWLSDENSLRKHMYMHLDAASLRQWKCEQCGLEKGSRAKLAAHIRYHHPKEYHKCTH 450

  Fly   557 CSKTFTQRGDCQMHQRTHQGERIYICPVCNEEFKSMPEMRSHLAGHEQHDKRLVH 611
            |:|.|......:.|..||.|:.:|.|..|...||:...|..|        :|.:|
  Fly   451 CAKEFKSSRSLEEHTATHTGQDLYECAFCERTFKNSGNMHKH--------RRQMH 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071 18/78 (23%)
C2H2 Zn finger 331..354 CDD:275368 2/25 (8%)
COG5048 <357..570 CDD:227381 66/230 (29%)
C2H2 Zn finger 360..380 CDD:275368 5/19 (26%)
C2H2 Zn finger 385..406 CDD:275370 8/27 (30%)
C2H2 Zn finger 414..434 CDD:275368 7/19 (37%)
zf-H2C2_2 427..451 CDD:290200 9/23 (39%)
C2H2 Zn finger 442..490 CDD:275368 18/51 (35%)
C2H2 Zn finger 470..487 CDD:275368 6/16 (38%)
zf-H2C2_2 482..507 CDD:290200 7/28 (25%)
C2H2 Zn finger 498..518 CDD:275368 6/19 (32%)
zf-H2C2_2 510..534 CDD:290200 8/26 (31%)
C2H2 Zn finger 526..546 CDD:275368 5/19 (26%)
zf-H2C2_2 539..563 CDD:290200 8/23 (35%)
C2H2 Zn finger 554..574 CDD:275368 5/19 (26%)
C2H2 Zn finger 582..602 CDD:275368 6/19 (32%)
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 18/78 (23%)
C2H2 Zn finger 268..289 CDD:275368 6/20 (30%)
C2H2 Zn finger 299..319 CDD:275368 7/19 (37%)
C2H2 Zn finger 327..348 CDD:275368 8/20 (40%)
C2H2 Zn finger 357..376 CDD:275368 7/18 (39%)
C2H2 Zn finger 389..409 CDD:275368 6/19 (32%)
C2H2 Zn finger 420..440 CDD:275368 5/19 (26%)
C2H2 Zn finger 448..468 CDD:275368 5/19 (26%)
C2H2 Zn finger 476..494 CDD:275368 6/25 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.