DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6654 and CG18262

DIOPT Version :9

Sequence 1:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster


Alignment Length:402 Identity:105/402 - (26%)
Similarity:162/402 - (40%) Gaps:84/402 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 KHQTPVGSKEEARELEKEQVPQSAKRTSRRRGVVKQDVPATPPSDAEPSPKQHRLGTQRKLSAPR 308
            ||.|...|...:.|||.:.:.|..........:.::......| |.|...::...|::|:.....
  Fly    53 KHFTNSSSSLCSNELESDPIAQDVVEVQGNEELHEELAKEASP-DLEEEEEEKEEGSKRQHYQRA 116

  Fly   309 AGTVN--------------------------------GPS---TTSGAATTPELKYHCDRCNAGF 338
            |...|                                |.|   .|..:..|.::.:.||:|:..:
  Fly   117 AAMKNTLVETREDLLDIELDWTGGEQSEHNETHEEEEGESDDDDTKDSNDTKDMLFQCDQCDRAY 181

  Fly   339 AVEKSLMIHRRQKGCINRNYKCNECEKVFVSPDHLAEHQASHGAHNCPECGIRCDSKEALSKHMV 403
            ..::||..|||.|                        |..::|.              :|.|...
  Fly   182 NTKRSLQSHRRLK------------------------HSEANGG--------------SLDKSAS 208

  Fly   404 QGHKRNLRN-----QCN--ICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNANLRQHKLR 461
            :.:.:..:.     :||  .|.:.|.....||.|...|||   ..|:||||.|||:.|:.:|:.|
  Fly   209 ERNSKKRKGPPKVYKCNEEACNQTFRTERDLRGHRWKHTG---IFCDICGKPFTQSGNMMRHRQR 270

  Fly   462 HSETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSLAKHKRKHTGERPYAC 526
            ||..|..||..|..:|.|:.||:||:..|||..|..||||.........|..|.|:||||||..|
  Fly   271 HSGIKPHKCPECDATFYTQKELSSHSICHTGRMPCICEVCGRPCRDRGVLTAHMRRHTGERPAKC 335

  Fly   527 DLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRTHQGERIYICPVCNEEFKS 591
            ::|...|.:.:.|..|..:||..||:||..|..||.::...::|:..|..:|.|.|.:|.:.|..
  Fly   336 EVCGKAFYSFHDLNVHAVSHTNLRPFVCDVCGSTFQRKKALRVHKLLHSEQRKYACKLCGKTFAQ 400

  Fly   592 MPEMRSHLAGHE 603
            ...:.:|:..|:
  Fly   401 SGGLNAHMRSHD 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 9/22 (41%)
COG5048 <357..570 CDD:227381 68/219 (31%)
C2H2 Zn finger 360..380 CDD:275368 1/19 (5%)
C2H2 Zn finger 385..406 CDD:275370 2/20 (10%)
C2H2 Zn finger 414..434 CDD:275368 7/21 (33%)
zf-H2C2_2 427..451 CDD:290200 12/23 (52%)
C2H2 Zn finger 442..490 CDD:275368 23/47 (49%)
C2H2 Zn finger 470..487 CDD:275368 7/16 (44%)
zf-H2C2_2 482..507 CDD:290200 12/24 (50%)
C2H2 Zn finger 498..518 CDD:275368 7/19 (37%)
zf-H2C2_2 510..534 CDD:290200 11/23 (48%)
C2H2 Zn finger 526..546 CDD:275368 5/19 (26%)
zf-H2C2_2 539..563 CDD:290200 11/23 (48%)
C2H2 Zn finger 554..574 CDD:275368 5/19 (26%)
C2H2 Zn finger 582..602 CDD:275368 4/19 (21%)
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 7/21 (33%)
C2H2 Zn finger 251..271 CDD:275368 10/19 (53%)
COG5048 <256..415 CDD:227381 59/157 (38%)
zf-H2C2_2 263..288 CDD:290200 10/24 (42%)
C2H2 Zn finger 279..327 CDD:275368 19/47 (40%)
zf-H2C2_2 320..342 CDD:290200 11/21 (52%)
C2H2 Zn finger 335..355 CDD:275368 5/19 (26%)
C2H2 Zn finger 363..383 CDD:275368 5/19 (26%)
zf-C2H2 389..411 CDD:278523 5/21 (24%)
C2H2 Zn finger 391..411 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.