DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6654 and Insm2

DIOPT Version :9

Sequence 1:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_006240173.1 Gene:Insm2 / 314131 RGDID:1306949 Length:495 Species:Rattus norvegicus


Alignment Length:406 Identity:91/406 - (22%)
Similarity:126/406 - (31%) Gaps:132/406 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 VPQS--AKRTSRRRGVVKQDVPATPPSDAEP--------------SPKQHRLGTQRKLSAPRAGT 311
            ||.|  |....:|||......|:.|.:..:|              ||.   ||.:.|...|.|  
  Rat   131 VPVSVPAPHGLQRRGKGAPGCPSAPAAVRKPKAVRRLSFADEVTTSPV---LGLKIKEEEPGA-- 190

  Fly   312 VNGPSTTSGAATTPELKYHCDRCNAGFAVEKSLMIHRRQKGCINRNYKCNECEKVFVSPDHLAEH 376
               |:...|...||..::.|..|...:|...:|..||..: .:...|:|.||:|||..|.:||.|
  Rat   191 ---PARALGGVRTPLGEFICQLCKQQYADPFALAQHRCSR-IVRVEYRCPECDKVFSCPANLASH 251

  Fly   377 QASHGAHNCPEC------------------------------------------GIRCDSKEALS 399
            :..|.....|.|                                          |...|| .||.
  Rat   252 RRWHKPRPTPACTASKPPHAPLTPPDPSLAAGKENGCLPRTEDQHPQARDSSGDGQHRDS-AALP 315

  Fly   400 KHMVQGHKRNLRNQCNICQKVFTMLSTLRDHMRIHTGEKP-----------FVCNICGKSFTQNA 453
            ......|....|.|....:.:      |..|     |.:|           |||..|.|.|.:.|
  Rat   316 GLQALVHPEAARPQAPYSEVI------LGRH-----GPRPSGASTGATSEVFVCPYCHKKFRRQA 369

  Fly   454 NLRQHKLRHSETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSLAKHKRKH 518
            .||:|...| ||.|                                   ||.||    .....:.
  Rat   370 YLRKHLGTH-ETGS-----------------------------------ARATT----PGFGSER 394

  Fly   519 TGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRTHQGERIYICP 583
            |....:||.||...|.:.::.:.||..|......:.|......|:.|.....:.:.|  :|:.|.
  Rat   395 TAPLTFACPLCGAHFPSADIREKHRLWHAVREELLLPALVGAPTEAGPGGASEGSAQ--QIFSCK 457

  Fly   584 VCNEEFKSMPEMRSHL 599
            .|...|.|.|.:..|:
  Rat   458 YCPSTFFSSPGLTRHI 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 6/22 (27%)
COG5048 <357..570 CDD:227381 56/265 (21%)
C2H2 Zn finger 360..380 CDD:275368 10/19 (53%)
C2H2 Zn finger 385..406 CDD:275370 7/62 (11%)
C2H2 Zn finger 414..434 CDD:275368 2/19 (11%)
zf-H2C2_2 427..451 CDD:290200 10/34 (29%)
C2H2 Zn finger 442..490 CDD:275368 12/47 (26%)
C2H2 Zn finger 470..487 CDD:275368 0/16 (0%)
zf-H2C2_2 482..507 CDD:290200 2/24 (8%)
C2H2 Zn finger 498..518 CDD:275368 4/19 (21%)
zf-H2C2_2 510..534 CDD:290200 5/23 (22%)
C2H2 Zn finger 526..546 CDD:275368 6/19 (32%)
zf-H2C2_2 539..563 CDD:290200 4/23 (17%)
C2H2 Zn finger 554..574 CDD:275368 3/19 (16%)
C2H2 Zn finger 582..602 CDD:275368 6/18 (33%)
Insm2XP_006240173.1 C2H2 Zn finger 207..227 CDD:275368 6/19 (32%)
C2H2 Zn finger 235..255 CDD:275368 10/19 (53%)
zf-C2H2 356..378 CDD:278523 10/21 (48%)
C2H2 Zn finger 358..378 CDD:275368 8/19 (42%)
C2H2 Zn finger 402..422 CDD:275368 6/19 (32%)
C2H2 Zn finger 456..477 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.