DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6654 and Zbtb12

DIOPT Version :9

Sequence 1:	NP_650429.1	Gene:	CG6654 / 41831	FlyBaseID:	FBgn0038301	Length:	639	Species:	Drosophila melanogaster
Sequence 2:	NP_001128463.1	Gene:	Zbtb12 / 309613	RGDID:	1302958	Length:	459	Species:	Rattus norvegicus

Alignment Length:	112	Identity:	40/112 - (35%)
Similarity:	61/112 - (54%)	Gaps:	3/112 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   356 RNYKCNECEKVFVSPDHLAEH-QASHGAHNCPECGIRCDSKEALSKHMVQGHKRNLRNQCNICQK 419
            :|.||.:|.:||...:.|..| :|.|....||.||.:.:....|::|| ..|:....:.|.||.|
  Rat   331 KNIKCTKCPEVFQGVEKLVFHMRAQHFIFMCPRCGKQFNHSSNLNRHM-NVHRGVKSHSCGICGK 394

  Fly   420 VFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNANLRQH-KLRHSET 465
            .||..|||.||:.:|:|.:|:.|:.|...|.....:|:| |.:|.:|
  Rat   395 CFTQKSTLHDHLNLHSGARPYRCSYCDVRFAHKPAIRRHLKEQHGKT 441

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6654	NP_650429.1	zf-AD	6..79	CDD:285071
		C2H2 Zn finger	331..354	CDD:275368
		COG5048	<357..570	CDD:227381	40/111 (36%)
		C2H2 Zn finger	360..380	CDD:275368	7/20 (35%)
		C2H2 Zn finger	385..406	CDD:275370	7/20 (35%)
		C2H2 Zn finger	414..434	CDD:275368	11/19 (58%)
		zf-H2C2_2	427..451	CDD:290200	9/23 (39%)
		C2H2 Zn finger	442..490	CDD:275368	8/25 (32%)
		C2H2 Zn finger	470..487	CDD:275368
		zf-H2C2_2	482..507	CDD:290200
		C2H2 Zn finger	498..518	CDD:275368
		zf-H2C2_2	510..534	CDD:290200
		C2H2 Zn finger	526..546	CDD:275368
		zf-H2C2_2	539..563	CDD:290200
		C2H2 Zn finger	554..574	CDD:275368
		C2H2 Zn finger	582..602	CDD:275368
Zbtb12	NP_001128463.1	BTB_POZ_ZBTB12	8..129	CDD:349512
		SUF4-like	333..>382	CDD:411020	16/49 (33%)
		C2H2 Zn finger	335..356	CDD:411020	7/20 (35%)
		C2H2 Zn finger	335..355	CDD:275368	6/19 (32%)
		zf-C2H2	359..381	CDD:395048	7/22 (32%)
		COG5048	<361..>448	CDD:227381	30/82 (37%)
		C2H2 Zn finger	361..381	CDD:411020	7/20 (35%)
		C2H2 Zn finger	361..381	CDD:275368	7/20 (35%)
		zf-H2C2_2	373..398	CDD:404364	9/25 (36%)
		C2H2 Zn finger	389..409	CDD:275368	11/19 (58%)
		C2H2 Zn finger	417..435	CDD:275368	5/17 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000