DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6654 and Zbtb45

DIOPT Version :9

Sequence 1:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001100948.1 Gene:Zbtb45 / 308366 RGDID:1310920 Length:519 Species:Rattus norvegicus


Alignment Length:107 Identity:40/107 - (37%)
Similarity:57/107 - (53%) Gaps:1/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   496 FECEVCLARFTTSCSLAKHKRKHTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKT 560
            :||..|...|::..:..||...|:||:|:.|.:|...|:..:.|..|..||||.|.:.|..|:|.
  Rat   411 YECSHCRKTFSSRKNYTKHMFIHSGEKPHQCAVCWRSFSLRDYLLKHMVTHTGVRAFQCAVCAKR 475

  Fly   561 FTQRGDCQMHQRTHQGERIYICPVCNEEFKSMPEMRSHLAGH 602
            |||:....:|.|||:.||. .||.|.:.|.....:..|||.|
  Rat   476 FTQKSSLNVHMRTHRPERA-PCPACGKVFSHRALLERHLAAH 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368
COG5048 <357..570 CDD:227381 26/73 (36%)
C2H2 Zn finger 360..380 CDD:275368
C2H2 Zn finger 385..406 CDD:275370
C2H2 Zn finger 414..434 CDD:275368
zf-H2C2_2 427..451 CDD:290200
C2H2 Zn finger 442..490 CDD:275368
C2H2 Zn finger 470..487 CDD:275368
zf-H2C2_2 482..507 CDD:290200 4/10 (40%)
C2H2 Zn finger 498..518 CDD:275368 5/19 (26%)
zf-H2C2_2 510..534 CDD:290200 8/23 (35%)
C2H2 Zn finger 526..546 CDD:275368 5/19 (26%)
zf-H2C2_2 539..563 CDD:290200 11/23 (48%)
C2H2 Zn finger 554..574 CDD:275368 8/19 (42%)
C2H2 Zn finger 582..602 CDD:275368 7/19 (37%)
Zbtb45NP_001100948.1 BTB 23..122 CDD:279045
BTB 34..124 CDD:197585
zf-C2H2 411..433 CDD:278523 6/21 (29%)
COG5048 <413..>480 CDD:227381 25/66 (38%)
C2H2 Zn finger 413..433 CDD:275368 5/19 (26%)
zf-H2C2_2 425..449 CDD:290200 8/23 (35%)
C2H2 Zn finger 441..461 CDD:275368 5/19 (26%)
zf-H2C2_2 453..478 CDD:290200 11/24 (46%)
zf-C2H2 467..489 CDD:278523 8/21 (38%)
C2H2 Zn finger 469..489 CDD:275368 8/19 (42%)
zf-H2C2_2 481..505 CDD:290200 10/24 (42%)
C2H2 Zn finger 496..516 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.