DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6654 and Zbtb2

DIOPT Version :9

Sequence 1:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001100930.1 Gene:Zbtb2 / 308126 RGDID:1306621 Length:514 Species:Rattus norvegicus


Alignment Length:429 Identity:90/429 - (20%)
Similarity:145/429 - (33%) Gaps:133/429 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 LQVQGNLKDEKEVVFTQTNVIY--EGDDHELEQQIRECNLAIFEGVDNEAEIITVTAPQVTTRKS 232
            |..||.. ...|.||...:.:|  :..||:| :|..:.||                .|:...|:.
  Rat   113 LASQGTF-SHPEQVFPLASSLYGIQIADHQL-RQATKMNL----------------GPEKLGREP 159

  Fly   233 AAKLLTQQENDKHQTPVGSKEEAREL--------EKEQVPQSAKRTSRRRGVVKQDVPATPPSDA 289
                 ..|.:..:|.||....:..:|        .....|....:||....:|...||..||   
  Rat   160 -----RPQASRMNQEPVPETSQLSQLTSNLAQVNRTNMTPADPLQTSLSPELVSTPVPPPPP--- 216

  Fly   290 EPSPKQHRLGTQRKLSAPRAGTVNGPSTTSGAATTPELKYHCDRCNAGFAVEKSLMIHRRQKGCI 354
                     |.:..|.|  :.:...||:.:.|...|                 |:|   ::.|..
  Rat   217 ---------GEETNLEA--SSSDEQPSSLTIAHVKP-----------------SIM---KRNGSF 250

  Fly   355 NRNYKCNECEKVFVSPDHLAEHQASH----------------------------GAHNCPECGIR 391
            .:.|.|:.|.:.|.....|.||...|                            .|...||.|:.
  Rat   251 PKYYACHLCGRRFTLRSSLREHLQIHTGVPFTAGPPGEGRGPLSLCSNAADLGKDALEVPEAGMI 315

  Fly   392 CDS--KEALSKHMVQGHKR-------------NL------------RNQCNICQKVFTMLSTLRD 429
            .||  :......::.|.::             ||            :.:|.||.:.|...|..|:
  Rat   316 SDSELQHISDSPIIDGQQQSETPPPSDIADIDNLEQADQEREVKRRKYECTICGRKFIQKSHWRE 380

  Fly   430 HMRIHTGEKPFVCNICGKSFTQNANLRQHKLRHSETKSF------KCELCPHSFVTKAELTSHAR 488
            ||.|||| |||.|:.|.|||.:.....:|...:....::      ..|||  :|...:::.:  .
  Rat   381 HMYIHTG-KPFKCSTCDKSFCRANQAARHVCLNQSIDTYTMVDKQTLELC--TFEEGSQMDN--M 440

  Fly   489 THTGDKPFECEVCLARFTTSCSLAKHKRKHTGERPYACD 527
            ....:||::|.:|...|:|...:.||..::.....:|.|
  Rat   441 LVQANKPYKCNLCDKTFSTPNEVVKHSCQNQNSDVFALD 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 3/22 (14%)
COG5048 <357..570 CDD:227381 52/232 (22%)
C2H2 Zn finger 360..380 CDD:275368 6/19 (32%)
C2H2 Zn finger 385..406 CDD:275370 5/22 (23%)
C2H2 Zn finger 414..434 CDD:275368 8/19 (42%)
zf-H2C2_2 427..451 CDD:290200 15/23 (65%)
C2H2 Zn finger 442..490 CDD:275368 10/53 (19%)
C2H2 Zn finger 470..487 CDD:275368 4/16 (25%)
zf-H2C2_2 482..507 CDD:290200 5/24 (21%)
C2H2 Zn finger 498..518 CDD:275368 6/19 (32%)
zf-H2C2_2 510..534 CDD:290200 4/18 (22%)
C2H2 Zn finger 526..546 CDD:275368 1/2 (50%)
zf-H2C2_2 539..563 CDD:290200
C2H2 Zn finger 554..574 CDD:275368
C2H2 Zn finger 582..602 CDD:275368
Zbtb2NP_001100930.1 BTB_POZ_ZBTB2 3..117 CDD:349502 1/3 (33%)
zf-C2H2 254..276 CDD:395048 7/21 (33%)
C2H2 Zn finger 256..276 CDD:275368 6/19 (32%)
zf-C2H2 363..385 CDD:395048 8/21 (38%)
C2H2 Zn finger 365..385 CDD:275368 8/19 (42%)
zf-H2C2_2 377..399 CDD:404364 13/22 (59%)
C2H2 Zn finger 392..416 CDD:275368 6/23 (26%)
C2H2 Zn finger 450..466 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.