DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6654 and Zbtb37

DIOPT Version :9

Sequence 1:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001100661.1 Gene:Zbtb37 / 304918 RGDID:1308731 Length:504 Species:Rattus norvegicus


Alignment Length:401 Identity:90/401 - (22%)
Similarity:131/401 - (32%) Gaps:119/401 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 ELEQQIRECNLAIFEGVDNEAEIITVTAPQVTTRKS----------AAKLLTQQENDKHQTPVGS 251
            :::..|.:|. .|.||:..:..:..|.|....||..          ....||:..:.:|....|:
  Rat   112 QMQHIIDKCT-QILEGIHFKINVAEVEAELSQTRTKHPERPPESHRVTPNLTRSLSPRHNASKGN 175

  Fly   252 KE-------EAREL---EKEQVPQSAKRTSRRRGVVKQDVPATPPSDAEPSPKQHRLG------- 299
            ..       :.|||   |:...||..:::|...|             .||..:.:|.|       
  Rat   176 WRGQVSAVLDIRELSPPEESTSPQIIEQSSDVEG-------------REPILRINRAGQWYVETG 227

  Fly   300 ----------TQRKLSAPR---------AGTVNGPSTTSGAATTPELKYHCDRCNAGFAVEKSLM 345
                      ..|.|.|..         .|..|.||...|::.........|....|...::|..
  Rat   228 IADQGPQSGDEVRVLGAVHIKTENLEEWLGPENQPSGEDGSSAEEVAAMVIDTTGHGSVGQESYT 292

  Fly   346 IHRRQKGCINRNYKCNECEKVFVSPDHLAEHQASHGAHNCPECGIRCDSKEALSKHM-------V 403
            :  ...|........:|.:: |.....:......|.|.:  |...|.|..:.||..:       |
  Rat   293 L--GSSGAKVARPTSSEVDR-FSPSGSVVSMTERHRARS--ESPGRMDEPKQLSSQVEESAMMGV 352

  Fly   404 QGHKRNLRNQ--------------CNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNAN 454
            ..:...||.|              |..|.|.|....:|..|||:|.|..||||.:|||.:|:   
  Rat   353 SAYVEYLREQEVSERWFRYNPRLTCIYCAKSFNQKGSLDRHMRLHMGITPFVCRMCGKKYTR--- 414

  Fly   455 LRQHKLRHSETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSLAKHKRK-H 518
                                     |.:|..|.|.|||:|||.|.||...|.....|.:|.|| |
  Rat   415 -------------------------KDQLEYHIRKHTGNKPFHCHVCGKSFPFQAILNQHFRKNH 454

  Fly   519 TG----ERPYA 525
            .|    |.|::
  Rat   455 PGCIPLEGPHS 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 4/22 (18%)
COG5048 <357..570 CDD:227381 53/195 (27%)
C2H2 Zn finger 360..380 CDD:275368 2/19 (11%)
C2H2 Zn finger 385..406 CDD:275370 6/27 (22%)
C2H2 Zn finger 414..434 CDD:275368 8/19 (42%)
zf-H2C2_2 427..451 CDD:290200 13/23 (57%)
C2H2 Zn finger 442..490 CDD:275368 9/47 (19%)
C2H2 Zn finger 470..487 CDD:275368 2/16 (13%)
zf-H2C2_2 482..507 CDD:290200 13/24 (54%)
C2H2 Zn finger 498..518 CDD:275368 8/20 (40%)
zf-H2C2_2 510..534 CDD:290200 8/21 (38%)
C2H2 Zn finger 526..546 CDD:275368 90/401 (22%)
zf-H2C2_2 539..563 CDD:290200
C2H2 Zn finger 554..574 CDD:275368
C2H2 Zn finger 582..602 CDD:275368
Zbtb37NP_001100661.1 BTB_POZ_ZBTB37 9..131 CDD:349531 5/19 (26%)
C2H2 Zn finger 377..397 CDD:275368 8/19 (42%)
zf-H2C2_2 389..414 CDD:404364 13/24 (54%)
zf-C2H2 403..425 CDD:395048 11/49 (22%)
C2H2 Zn finger 405..425 CDD:275368 9/47 (19%)
zf-H2C2_2 418..440 CDD:404364 12/21 (57%)
DUF4764 <429..>497 CDD:406387 15/37 (41%)
C2H2 Zn finger 433..451 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.