DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6654 and Zbtb6

DIOPT Version :9

Sequence 1:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_666365.1 Gene:Zbtb6 / 241322 MGIID:2442998 Length:423 Species:Mus musculus


Alignment Length:399 Identity:86/399 - (21%)
Similarity:138/399 - (34%) Gaps:133/399 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 VEKTT---SLILQVQGNLKDEKEVVFTQTNVIYEGDDHELEQQIRECNLAIFEGVDNEAEIITVT 223
            |||.|   |..|::..::|:.:.....|::      |.:::.:        .|..|.:.|||.::
Mouse   116 VEKCTEALSKYLEIDLSMKNNQHTDLCQSS------DTDVKNE--------EENSDKDCEIIEIS 166

  Fly   224 APQVTTRKSAAKLLTQQENDKHQTPVGSKEEARELEKEQVPQSAKRTSRRRGVVKQDVPATPPSD 288
                                 ..:||......:| |:....|||..|                  
Mouse   167 ---------------------EDSPVNLDFHVKE-EESNALQSAAET------------------ 191

  Fly   289 AEPSPKQHRLGTQR-KLSAPRAGTVNG------------PSTTSGAATTPELKYHCDRCNAGFAV 340
                     |.::| ::.:|....|:|            .|.::......:....|....||   
Mouse   192 ---------LTSERMRMQSPELSAVDGGFKENEICILHVESISTDDVENGQFSQPCTSSKAG--- 244

  Fly   341 EKSLMIHRRQKGCINRNYKCNECEKVFVSPDHLAEHQASHGAHNCPECGIRCDSKEALSKHMVQG 405
               :.....|...||...: |...:|..:.:.....:.|.|:|.              :.:.:|.
Mouse   245 ---IYFPETQHSLINSTVE-NRVTEVPGNTNQGLFSENSDGSHG--------------TVNEIQN 291

  Fly   406 HKRN--LRNQCNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNANLRQHKLRHSETKSF 468
            ...|  ||:||..|.:.|..:.....|:::|   |.|:|..|||:|||..||.:           
Mouse   292 LDENFSLRHQCPRCPRGFLHVENYLRHLKMH---KLFLCLQCGKTFTQKKNLNR----------- 342

  Fly   469 KCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSLAKHKRKHTGERPYACDLCPMRF 533
                             |.|.|.|.:||:|.|||..||...:|..|...|:|:|||.|..|.|.|
Mouse   343 -----------------HIRGHMGIRPFQCTVCLKTFTAKSTLQDHLNIHSGDRPYKCHCCDMDF 390

  Fly   534 TALNVLKNH 542
            ...:.||.|
Mouse   391 KHKSALKKH 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 4/22 (18%)
COG5048 <357..570 CDD:227381 52/188 (28%)
C2H2 Zn finger 360..380 CDD:275368 2/19 (11%)
C2H2 Zn finger 385..406 CDD:275370 1/20 (5%)
C2H2 Zn finger 414..434 CDD:275368 4/19 (21%)
zf-H2C2_2 427..451 CDD:290200 9/23 (39%)
C2H2 Zn finger 442..490 CDD:275368 11/47 (23%)
C2H2 Zn finger 470..487 CDD:275368 0/16 (0%)
zf-H2C2_2 482..507 CDD:290200 11/24 (46%)
C2H2 Zn finger 498..518 CDD:275368 8/19 (42%)
zf-H2C2_2 510..534 CDD:290200 10/23 (43%)
C2H2 Zn finger 526..546 CDD:275368 7/17 (41%)
zf-H2C2_2 539..563 CDD:290200 3/4 (75%)
C2H2 Zn finger 554..574 CDD:275368
C2H2 Zn finger 582..602 CDD:275368
Zbtb6NP_666365.1 BTB 23..123 CDD:279045 4/6 (67%)
BTB 34..127 CDD:197585 5/10 (50%)
C2H2 Zn finger 302..322 CDD:275368 4/19 (21%)
zf-C2H2 325..347 CDD:278523 12/49 (24%)
C2H2 Zn finger 327..347 CDD:275368 11/47 (23%)
zf-H2C2_2 339..363 CDD:290200 12/51 (24%)
C2H2 Zn finger 355..375 CDD:275368 8/19 (42%)
C2H2 Zn finger 383..400 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.