DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6654 and Zbtb37

DIOPT Version :9

Sequence 1:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001343418.1 Gene:Zbtb37 / 240869 MGIID:2444467 Length:504 Species:Mus musculus


Alignment Length:381 Identity:91/381 - (23%)
Similarity:128/381 - (33%) Gaps:85/381 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 ELEQQIRECNLAIFEGVDNEAEIITVTAPQVTTRKSAAKLLTQQENDKHQ-TPVGSKEEARELEK 260
            :::..|.:|. .|.||:..:..:..|.|....||            .||| .|..|......|.:
Mouse   112 QMQHIIDKCT-QILEGIHFKINVAEVEAELSQTR------------TKHQERPPESHRATPNLNR 163

  Fly   261 EQVPQSAKRTSRRRGVVK----------QDVPATP-----PSDA---EPSPKQHRLG-------- 299
            ...|:........||.|.          .:.|.:|     .|||   ||..:.:|.|        
Mouse   164 SLSPRHNASKGNWRGQVSAVLDIRELSPPEEPTSPQIIEQSSDAEGREPILRINRAGQWYVETGL 228

  Fly   300 ---------TQRKLSAPR---------AGTVNGPSTTSGAATTPELKYHCDRCNAGFAVEKSLMI 346
                     ..|.|.|..         .|..|.||...|::.........|....|...::|..:
Mouse   229 ADQGARSGDEVRVLGAVHIKTENLEEWLGPENQPSGEDGSSAEEVTAMVIDTTGHGSIGQESYTL 293

  Fly   347 HRRQKGCINRNYKCNECEKVFVSPDHLAEHQASHGAHNCPECGIRCDSKEALSKHM-------VQ 404
              ...|........:|.:: |.....:......|.|.:  |...|.|..:.||..:       |.
Mouse   294 --GSSGAKVARPTSSEVDR-FSPSGSVVSMTERHRARS--ESPGRMDEPKQLSSQVEESAMMGVS 353

  Fly   405 GHKRNLRNQ--------------CNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNANL 455
            .:...||.|              |..|.|.|....:|..|||:|.|..||||.:|||.:|:...|
Mouse   354 AYVEYLREQEVSERWFRYNPRLTCIYCAKSFNQKGSLDRHMRLHMGITPFVCRMCGKKYTRKDQL 418

  Fly   456 RQHKLRHSETKSFKCELCPHSFVTKAELTSHAR-THTGDKPFECEVCLARFTTSCS 510
            ..|..:|:..|.|.|.:|..||..:|.|..|.| .|.|..|.|....::..||..|
Mouse   419 EYHIRKHTGNKPFHCHVCGKSFPFQAILNQHFRKNHPGCIPLEGPHSISPETTVTS 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 4/22 (18%)
COG5048 <357..570 CDD:227381 51/176 (29%)
C2H2 Zn finger 360..380 CDD:275368 2/19 (11%)
C2H2 Zn finger 385..406 CDD:275370 6/27 (22%)
C2H2 Zn finger 414..434 CDD:275368 8/19 (42%)
zf-H2C2_2 427..451 CDD:290200 13/23 (57%)
C2H2 Zn finger 442..490 CDD:275368 18/48 (38%)
C2H2 Zn finger 470..487 CDD:275368 6/16 (38%)
zf-H2C2_2 482..507 CDD:290200 7/25 (28%)
C2H2 Zn finger 498..518 CDD:275368 3/13 (23%)
zf-H2C2_2 510..534 CDD:290200 1/1 (100%)
C2H2 Zn finger 526..546 CDD:275368
zf-H2C2_2 539..563 CDD:290200
C2H2 Zn finger 554..574 CDD:275368
C2H2 Zn finger 582..602 CDD:275368
Zbtb37NP_001343418.1 BTB_POZ_ZBTB37 9..131 CDD:349531 5/19 (26%)
C2H2 Zn finger 377..397 CDD:275368 8/19 (42%)
zf-H2C2_2 389..414 CDD:404364 13/24 (54%)
zf-C2H2 403..425 CDD:395048 9/21 (43%)
C2H2 Zn finger 405..425 CDD:275368 7/19 (37%)
zf-H2C2_2 418..440 CDD:404364 7/21 (33%)
C2H2 Zn finger 433..451 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.