DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6654 and Zbtb45

DIOPT Version :9

Sequence 1:	NP_650429.1	Gene:	CG6654 / 41831	FlyBaseID:	FBgn0038301	Length:	639	Species:	Drosophila melanogaster
Sequence 2:	NP_001019870.1	Gene:	Zbtb45 / 232879	MGIID:	2685003	Length:	520	Species:	Mus musculus

Alignment Length:	107	Identity:	40/107 - (37%)
Similarity:	57/107 - (53%)	Gaps:	1/107 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   496 FECEVCLARFTTSCSLAKHKRKHTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKT 560
            :||..|...|::..:..||...|:||:|:.|.:|...|:..:.|..|..||||.|.:.|..|:|.
Mouse   412 YECSHCRKTFSSRKNYTKHMFIHSGEKPHQCAVCWRSFSLRDYLLKHMVTHTGVRAFQCAVCAKR 476

  Fly   561 FTQRGDCQMHQRTHQGERIYICPVCNEEFKSMPEMRSHLAGH 602
            |||:....:|.|||:.||. .||.|.:.|.....:..|||.|
Mouse   477 FTQKSSLNVHMRTHRPERA-PCPACGKVFSHRALLERHLAAH 517

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6654	NP_650429.1	zf-AD	6..79	CDD:285071
		C2H2 Zn finger	331..354	CDD:275368
		COG5048	<357..570	CDD:227381	26/73 (36%)
		C2H2 Zn finger	360..380	CDD:275368
		C2H2 Zn finger	385..406	CDD:275370
		C2H2 Zn finger	414..434	CDD:275368
		zf-H2C2_2	427..451	CDD:290200
		C2H2 Zn finger	442..490	CDD:275368
		C2H2 Zn finger	470..487	CDD:275368
		zf-H2C2_2	482..507	CDD:290200	4/10 (40%)
		C2H2 Zn finger	498..518	CDD:275368	5/19 (26%)
		zf-H2C2_2	510..534	CDD:290200	8/23 (35%)
		C2H2 Zn finger	526..546	CDD:275368	5/19 (26%)
		zf-H2C2_2	539..563	CDD:290200	11/23 (48%)
		C2H2 Zn finger	554..574	CDD:275368	8/19 (42%)
		C2H2 Zn finger	582..602	CDD:275368	7/19 (37%)
Zbtb45	NP_001019870.1	BTB_POZ_ZBTB45	15..126	CDD:349538
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	182..272
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	337..372
		zf-C2H2	412..434	CDD:333835	6/21 (29%)
		C2H2 Zn finger	414..434	CDD:275368	5/19 (26%)
		C2H2 Zn finger	442..462	CDD:275368	5/19 (26%)
		zf-H2C2_2	454..479	CDD:372612	11/24 (46%)
		zf-C2H2	468..490	CDD:333835	8/21 (38%)
		C2H2 Zn finger	470..490	CDD:275368	8/19 (42%)
		C2H2 Zn finger	497..517	CDD:275368	7/19 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000