DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6654 and Zbtb12

DIOPT Version :9

Sequence 1:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_942589.3 Gene:Zbtb12 / 193736 MGIID:88133 Length:459 Species:Mus musculus


Alignment Length:463 Identity:106/463 - (22%)
Similarity:155/463 - (33%) Gaps:120/463 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLSIYDGGSGSCLADMIREFTKTKPRRNDNLPEKVCLSCLSEISNCYTFKIKCE----------N 71
            |||.|.|.....:.|::...|.....:.:::.||    |.:.:|.....||..:          :
Mouse    85 LLSCYTGALEFAVRDIVNYLTAASYLQMEHVVEK----CRNALSQFIEPKIGLKEDGVSEASLLS 145

  Fly    72 SSRTLRQLLPNALPEEPDSKVSISCPVATTDQAVQTTSWEPDRCTASVQTDAVTTTDAEQNTSLI 136
            |....:.|||.|...:|..|.....|:             |......|:.:.....|.|      
Mouse   146 SVSATKSLLPPARTPKPAPKPPPPPPL-------------PPPLLRPVKLEFPLDEDLE------ 191

  Fly   137 KSTISVDLDYEGEGEVFDYELPDEPVEKTTSLILQVQGNLKDEKEVVFTQTNVIYEGDDH--ELE 199
                   |..|.|.|..|.::.|..:.|..| .|:|...||....:. ....:......|  ||.
Mouse   192 -------LKAEEEDEDEDEDVSDICIVKVES-ALEVAHRLKPPGSLA-GGLGIGASVSSHLGELA 247

  Fly   200 QQIRECNLAIFEGVDNEAEIITVTAPQVTTRKSAAKLLTQQENDKHQTPVGSKEEARELEKEQVP 264
            |.....|              |||.||... |:...|               .|:|.......:|
Mouse   248 QSSVAPN--------------TVTPPQGVV-KACYSL---------------SEDAEGEGLLLIP 282

  Fly   265 QSAKRTSRRRGVVKQDVPATPPSDAEPSPKQHRLGTQRKLSAPRAGTVNGPSTTSGAATTPELKY 329
            ..........|:|:....|.....|..|     ||         ||...||              
Mouse   283 GGRASVGATSGLVEAAAVAMAARGAGGS-----LG---------AGGSRGP-------------- 319

  Fly   330 HCDRCNAGFAVEKSLMIHRRQKGCINRNYKCNECEKVFVSPDHLAEH-QASHGAHNCPECGIRCD 393
                ...||:....|           :|.||.:|.:||...:.|..| :|.|....||.||.:.:
Mouse   320 ----LPGGFSSGNPL-----------KNIKCTKCPEVFQGVEKLVFHMRAQHFIFMCPRCGKQFN 369

  Fly   394 SKEALSKHMVQGHKRNLRNQCNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNANLRQH 458
            ....|::|| ..|:....:.|.||.|.||..|||.||:.:|:|.:|:.|:.|...|.....:|:|
Mouse   370 HSSNLNRHM-NVHRGVKSHSCGICGKCFTQKSTLHDHLNLHSGARPYRCSYCDVRFAHKPAIRRH 433

  Fly   459 -KLRHSET 465
             |.:|.:|
Mouse   434 LKEQHGKT 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071 14/71 (20%)
C2H2 Zn finger 331..354 CDD:275368 3/22 (14%)
COG5048 <357..570 CDD:227381 40/111 (36%)
C2H2 Zn finger 360..380 CDD:275368 7/20 (35%)
C2H2 Zn finger 385..406 CDD:275370 7/20 (35%)
C2H2 Zn finger 414..434 CDD:275368 11/19 (58%)
zf-H2C2_2 427..451 CDD:290200 9/23 (39%)
C2H2 Zn finger 442..490 CDD:275368 8/25 (32%)
C2H2 Zn finger 470..487 CDD:275368
zf-H2C2_2 482..507 CDD:290200
C2H2 Zn finger 498..518 CDD:275368
zf-H2C2_2 510..534 CDD:290200
C2H2 Zn finger 526..546 CDD:275368
zf-H2C2_2 539..563 CDD:290200
C2H2 Zn finger 554..574 CDD:275368
C2H2 Zn finger 582..602 CDD:275368
Zbtb12NP_942589.3 BTB_POZ_ZBTB12 8..129 CDD:349512 11/47 (23%)
C2H2 Zn finger 335..355 CDD:275368 6/19 (32%)
zf-C2H2 359..381 CDD:333835 7/22 (32%)
COG5048 <361..>448 CDD:227381 30/82 (37%)
C2H2 Zn finger 361..381 CDD:275368 7/20 (35%)
zf-H2C2_2 373..398 CDD:372612 9/25 (36%)
C2H2 Zn finger 389..409 CDD:275368 11/19 (58%)
C2H2 Zn finger 417..435 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.