DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6654 and ZNF846

DIOPT Version :9

Sequence 1:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001071092.1 Gene:ZNF846 / 162993 HGNCID:27260 Length:533 Species:Homo sapiens


Alignment Length:474 Identity:138/474 - (29%)
Similarity:201/474 - (42%) Gaps:66/474 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 DEPVEKTTSLIL---------QVQGNLKDEKEVVFTQTNVIYEGDDHELEQQIRECNLAIFEGVD 214
            |..:|...:||:         .:...|:..:|:....|.|:     .||:.|::.....:.:.:.
Human    35 DVMLENYKNLIILAGSELFKRSLMSGLEQMEELRTGVTGVL-----QELDLQLKTKGSPLLQDIS 94

  Fly   215 NEAEIITVTAPQVTTRKSAAKLLTQQENDK----------HQ-TPVGSK-----EEARELEKEQV 263
            .|.   :....|:....:|.||.....:.|          |. |.:|.|     :..:.|.| ..
Human    95 AER---SPNGVQLERSNTAEKLYDSNHSGKVFNEHPFLMTHMITHIGEKTSEDNQSGKALRK-NF 155

  Fly   264 PQSAKRTSRRRGVVKQDVPATPPSDAEPS-PKQHRLGTQRKLSAPRAGTVNGPSTTSGAATTPEL 327
            |.|..:.|...|.:.:.|......:..|: .:|::..||.||.                      
Human   156 PHSFYKKSHAEGKMPKCVKHEKAFNQFPNLTRQNKTHTQEKLC---------------------- 198

  Fly   328 KYHCDRCNAGFAVEKSLMIH-RRQKGCINRNYKCNECEKVFVSPDHLAEHQASHGAHN---CPEC 388
              .|..|...|..:.||.:| |...|  :::|.|.||.|.|.:..||..|...|....   |.||
Human   199 --ECKDCWRTFLNQSSLKLHIRSHNG--DKHYVCKECGKAFSNSSHLIGHGRIHSGEKPYVCKEC 259

  Fly   389 GIRCDSKEALSKHMVQGHKRNLRNQCNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNA 453
            |........|..| ::.|......:|..|.|.||..|.|.||.|||:|:||:||..|||:||::.
Human   260 GKAFTQSTGLKLH-IRTHSGEKPYKCKECGKAFTHSSYLTDHTRIHSGKKPYVCMECGKAFTRST 323

  Fly   454 NLRQHKLRHSETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSLAKHKRKH 518
            .|..|...|:..|.::|:.|..:|:..:.||.|.|.|:|:|.:.|:.|...||.|..|..|.|.|
Human   324 GLILHMRIHTGEKPYECKECGKAFIHSSYLTKHVRIHSGEKLYLCKACGKAFTRSSGLVLHMRTH 388

  Fly   519 TGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRTHQGERIYICP 583
            |||:||.|..|...|...::|..|.|.||||:||.|..|.|.|||......|.|||.||:...|.
Human   389 TGEKPYECKECGKAFNNSSMLSQHVRIHTGEKPYECKECGKAFTQSSGLSTHLRTHTGEKACECK 453

  Fly   584 VCNEEFKSMPEMRSHLAGH 602
            .|.:.|.....:..|:..|
Human   454 ECGKAFARSTNLNMHMRTH 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 8/23 (35%)
COG5048 <357..570 CDD:227381 85/215 (40%)
C2H2 Zn finger 360..380 CDD:275368 8/19 (42%)
C2H2 Zn finger 385..406 CDD:275370 6/20 (30%)
C2H2 Zn finger 414..434 CDD:275368 10/19 (53%)
zf-H2C2_2 427..451 CDD:290200 15/23 (65%)
C2H2 Zn finger 442..490 CDD:275368 17/47 (36%)
C2H2 Zn finger 470..487 CDD:275368 5/16 (31%)
zf-H2C2_2 482..507 CDD:290200 10/24 (42%)
C2H2 Zn finger 498..518 CDD:275368 8/19 (42%)
zf-H2C2_2 510..534 CDD:290200 11/23 (48%)
C2H2 Zn finger 526..546 CDD:275368 6/19 (32%)
zf-H2C2_2 539..563 CDD:290200 13/23 (57%)
C2H2 Zn finger 554..574 CDD:275368 8/19 (42%)
C2H2 Zn finger 582..602 CDD:275368 4/19 (21%)
ZNF846NP_001071092.1 KRAB 8..67 CDD:214630 5/31 (16%)
KRAB 8..45 CDD:279668 2/9 (22%)
COG5048 106..496 CDD:227381 125/395 (32%)
C2H2 Zn finger 120..136 CDD:275368 2/15 (13%)
C2H2 Zn finger 200..220 CDD:275368 7/19 (37%)
C2H2 Zn finger 228..248 CDD:275368 8/19 (42%)
C2H2 Zn finger 256..276 CDD:275368 6/20 (30%)
zf-H2C2_2 269..293 CDD:290200 7/24 (29%)
C2H2 Zn finger 284..304 CDD:275368 10/19 (53%)
zf-H2C2_2 296..321 CDD:290200 15/24 (63%)
C2H2 Zn finger 312..332 CDD:275368 8/19 (42%)
zf-H2C2_2 328..347 CDD:290200 5/18 (28%)
zf-C2H2 338..360 CDD:278523 7/21 (33%)
C2H2 Zn finger 340..360 CDD:275368 7/19 (37%)
zf-H2C2_2 352..377 CDD:290200 10/24 (42%)
C2H2 Zn finger 368..388 CDD:275368 8/19 (42%)
zf-H2C2_2 381..405 CDD:290200 12/23 (52%)
C2H2 Zn finger 396..416 CDD:275368 6/19 (32%)
zf-H2C2_2 408..433 CDD:290200 13/24 (54%)
C2H2 Zn finger 424..444 CDD:275368 8/19 (42%)
zf-H2C2_2 437..461 CDD:290200 9/23 (39%)
C2H2 Zn finger 452..472 CDD:275368 4/19 (21%)
zf-H2C2_2 464..489 CDD:290200 2/9 (22%)
C2H2 Zn finger 480..500 CDD:275368
zf-H2C2_2 492..517 CDD:290200
C2H2 Zn finger 508..527 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.