DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6654 and ZBTB6

DIOPT Version :9

Sequence 1:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_006617.1 Gene:ZBTB6 / 10773 HGNCID:16764 Length:424 Species:Homo sapiens


Alignment Length:395 Identity:87/395 - (22%)
Similarity:144/395 - (36%) Gaps:124/395 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 VEKTT---SLILQVQGNLKDEKEVVFTQTNVIYEGDDHELEQQIRECNLAIFEGVDNEAEIITVT 223
            |||.|   |..|::..::|:.     .|...:.:..|.:::.:        .|..|.:.|||.::
Human   116 VEKCTEALSKYLEIDLSMKNN-----NQHTDLCQSSDPDVKNE--------DENSDKDCEIIEIS 167

  Fly   224 APQVTTRKSAAKLLTQQENDKHQTPVGSKEEARELEKEQVPQSAKR-TSRRRGVVKQDVPATPPS 287
                                 ..:||......:|.|...:..:.:. ||.|:.:...::     |
Human   168 ---------------------EDSPVNIDFHVKEEESNALQSTVESLTSERKEMKSPEL-----S 206

  Fly   288 DAEPSPKQHRLGTQRKLSAPRAGTVNG----PSTTSGAATTPELKYHCDRCNAGFAVEKSLMIHR 348
            ..:...|.:.:......|...||..||    |.|:|.|                     |:....
Human   207 TVDIGFKDNEICILHVESISTAGVENGQFSQPCTSSKA---------------------SMYFSE 250

  Fly   349 RQKGCINRNYKCNECEKVFVSPDHLAEHQASHGAHNCPECGIRCDSKE------ALSKHMVQGHK 407
            .|...||...:           ..:||...:.      :.|:.|::.|      :..:::.:|: 
Human   251 TQHSLINSTVE-----------SRVAEVPGNQ------DQGLFCENTEGSYGTVSEIQNLEEGY- 297

  Fly   408 RNLRNQCNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNANLRQHKLRHSETKSFKCEL 472
             :||:||..|.:.|..:.....|:::|   |.|:|..|||:|||..||.:               
Human   298 -SLRHQCPRCPRGFLHVENYLRHLKMH---KLFLCLQCGKTFTQKKNLNR--------------- 343

  Fly   473 CPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSLAKHKRKHTGERPYACDLCPMRFTALN 537
                         |.|.|.|.:||:|.|||..||...:|..|...|:|:|||.|..|.|.|...:
Human   344 -------------HIRGHMGIRPFQCTVCLKTFTAKSTLQDHLNIHSGDRPYKCHCCDMDFKHKS 395

  Fly   538 VLKNH 542
            .||.|
Human   396 ALKKH 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 2/22 (9%)
COG5048 <357..570 CDD:227381 51/192 (27%)
C2H2 Zn finger 360..380 CDD:275368 2/19 (11%)
C2H2 Zn finger 385..406 CDD:275370 3/26 (12%)
C2H2 Zn finger 414..434 CDD:275368 4/19 (21%)
zf-H2C2_2 427..451 CDD:290200 9/23 (39%)
C2H2 Zn finger 442..490 CDD:275368 11/47 (23%)
C2H2 Zn finger 470..487 CDD:275368 0/16 (0%)
zf-H2C2_2 482..507 CDD:290200 11/24 (46%)
C2H2 Zn finger 498..518 CDD:275368 8/19 (42%)
zf-H2C2_2 510..534 CDD:290200 10/23 (43%)
C2H2 Zn finger 526..546 CDD:275368 7/17 (41%)
zf-H2C2_2 539..563 CDD:290200 3/4 (75%)
C2H2 Zn finger 554..574 CDD:275368
C2H2 Zn finger 582..602 CDD:275368
ZBTB6NP_006617.1 BTB_POZ_ZBTB6 8..123 CDD:349506 4/6 (67%)
C2H2 Zn finger 303..323 CDD:275368 4/19 (21%)
zf-C2H2 326..348 CDD:395048 12/49 (24%)
C2H2 Zn finger 328..348 CDD:275368 11/47 (23%)
zf-C2H2_8 331..401 CDD:406359 34/98 (35%)
zf-H2C2_2 340..364 CDD:404364 12/51 (24%)
C2H2 Zn finger 356..376 CDD:275368 8/19 (42%)
C2H2 Zn finger 384..401 CDD:275368 7/17 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 402..424
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.