DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6654 and zbtb37

DIOPT Version :9

Sequence 1:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_004914082.1 Gene:zbtb37 / 100485471 XenbaseID:XB-GENE-979959 Length:583 Species:Xenopus tropicalis


Alignment Length:403 Identity:92/403 - (22%)
Similarity:143/403 - (35%) Gaps:108/403 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 ELEQQIRECNLAIFEGVDNEAEIITVTAPQVTTRKSAAK-LLTQQENDKHQTPVGSKEEARELE- 259
            :::..|.:|. .|.||:.     :.:::|:.....|.:: ...::..|.|:.   |:..:|.|. 
 Frog   175 QMQHIIDKCT-QILEGIH-----LKISSPESEEELSQSRPKHAERVQDAHRV---SQSLSRSLSP 230

  Fly   260 KEQVPQSAKRTSRRRGVVKQ--DVPATPPSDAEPSPKQHRLGTQ--------------------- 301
            :...|:|   :..|||.|..  |:....|::...||:....|:.                     
 Frog   231 RHSTPRS---SGSRRGQVSTVLDIRELSPAEESTSPQMVEQGSDVESREPILRINRAGQWYVETG 292

  Fly   302 ------------RKLSAPRAGTVN-----GP--------------------STTSGAATTPELKY 329
                        |.:.|.|..|.|     ||                    .||..:|||.| .|
 Frog   293 SADRGERSDDEVRVMGAMRIKTENLEEWLGPENQPSCEDGSSAEEVTAMVIDTTGHSATTQE-SY 356

  Fly   330 HCDRCNAGFAVEKSLMIHR-RQKGCINRNYKCNECEKVFVSPDHLAEHQASHGAHNCPECGIRCD 393
            .........:...|..|.| ...|.:           |.::..|.|:.::........:...:.|
 Frog   357 SLGSSGTKVSRPTSSEIDRFSPSGSV-----------VTMTERHRAKSESPRRMEEPKQNSSQGD 410

  Fly   394 SKEALSKHMVQGHKRNLRNQ--------------CNICQKVFTMLSTLRDHMRIHTGEKPFVCNI 444
            ....:.   |.|:...||.|              |..|.|.|....:|..|||:|.|..||||.:
 Frog   411 DAGVIG---VSGYVEYLREQEVSERWFRYNPRLTCIYCAKSFNQKGSLDRHMRLHMGITPFVCRM 472

  Fly   445 CGKSFTQNANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHAR-THTGDKPFECEVCLARFTTS 508
            |||.:|:...|..|..:|:..|.|.|.:|..||..:|.|..|.| .|.|..|||....::..||:
 Frog   473 CGKKYTRKDQLEYHIRKHTGNKPFHCHVCGKSFPFQAILNQHFRKNHPGCVPFEGPHSISPETTT 537

  Fly   509 CSLAKHKRKHTGE 521
            ...:   |..|||
 Frog   538 VVTS---RGPTGE 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 4/23 (17%)
COG5048 <357..570 CDD:227381 51/180 (28%)
C2H2 Zn finger 360..380 CDD:275368 3/19 (16%)
C2H2 Zn finger 385..406 CDD:275370 2/20 (10%)
C2H2 Zn finger 414..434 CDD:275368 8/19 (42%)
zf-H2C2_2 427..451 CDD:290200 13/23 (57%)
C2H2 Zn finger 442..490 CDD:275368 18/48 (38%)
C2H2 Zn finger 470..487 CDD:275368 6/16 (38%)
zf-H2C2_2 482..507 CDD:290200 8/25 (32%)
C2H2 Zn finger 498..518 CDD:275368 3/19 (16%)
zf-H2C2_2 510..534 CDD:290200 4/12 (33%)
C2H2 Zn finger 526..546 CDD:275368
zf-H2C2_2 539..563 CDD:290200
C2H2 Zn finger 554..574 CDD:275368
C2H2 Zn finger 582..602 CDD:275368
zbtb37XP_004914082.1 BTB 87..187 CDD:279045 2/12 (17%)
BTB 98..188 CDD:197585 3/13 (23%)
C2H2 Zn finger 442..462 CDD:275368 8/19 (42%)
zf-H2C2_2 454..479 CDD:290200 13/24 (54%)
zf-C2H2 468..490 CDD:278523 9/21 (43%)
C2H2 Zn finger 470..490 CDD:275368 7/19 (37%)
zf-H2C2_2 483..505 CDD:290200 7/21 (33%)
C2H2 Zn finger 498..516 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.