DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinb6c

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001369781.1 Gene:Serpinb6c / 97848 MGIID:2145481 Length:379 Species:Mus musculus


Alignment Length:403 Identity:121/403 - (30%)
Similarity:205/403 - (50%) Gaps:43/403 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQ- 97
            :.:....|:|.|:|.:.| ..|.|:|.||.|..:||::....:...|..::.|||:||...:.: 
Mouse     5 LLEANATFALNLLKILGE-DRSKNVFLSPISISSALVMVLLGAKGTTAIQITQALSLGKCSSSED 68

  Fly    98 -------QVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLLY----GATKELD 151
                   |:|:|        |.....:...|.:|||:|.::|.::...|....:    ...:|||
Mouse    69 GDVHQGFQLLLS--------EVNKTGTQYSLKAANRLFGEKTFDILASFKDSCHKFYEAEMEELD 125

  Fly   152 FKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPF 216
            ||...|...:.||.|:|.||.::|:::||...|..:|.|:|.||.|.||:|..||..|:|...||
Mouse   126 FKGATEQSRQHINTWVAKKTEDKIKELLSPGTIHSNTPLILVNAVYFKGKWEKQFNKEDTREMPF 190

  Fly   217 FINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNS 281
            .:::.|::.|.||.:...||||..|.:.::|:.|||               ..::::|||:||:.
Mouse   191 KVSKNEEKPVQMMFQKSTFKMTYVEEISTKILLLPY---------------VGNELNMIIMLPDE 240

  Fly   282 NKISLNRVISRLNADSVKKW--FERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTR-NAT 343
            : :.|:.|...:..:...:|  .:|...:|:|:.||.|:.|:..::..:|..:|:...|.. .|.
Mouse   241 H-VELSTVEKEITHEKFIEWTRLDRMKGEKVEVFLPWFKLEENYDMKDVLCKLGMTDAFEEGRAD 304

  Fly   344 FGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEK 408
            |..:::.. .|.:.:..|.:.::|:|.||.|.|||.:::..|||. .|. |..|.||:|.|...|
Mouse   305 FSGISSKQ-GLFLSNVIHKSVVEVNEEGSEATAATTIVLKGSSRS-TPC-FCVNRPFIFFIQHIK 366

  Fly   409 VDTILFAGVYSDP 421
            .:.|||.|..|.|
Mouse   367 TNEILFLGRLSSP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 119/395 (30%)
Serpinb6cNP_001369781.1 serpin 2..379 CDD:422956 120/401 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.