DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinb9g

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_035585.2 Gene:Serpinb9g / 93806 MGIID:1919260 Length:377 Species:Mus musculus


Alignment Length:397 Identity:104/397 - (26%)
Similarity:192/397 - (48%) Gaps:46/397 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNL--------GWALNKQ 97
            |::.|:|.:.:..||.|:.:||.|..:||.:....:...|..::.|||:|        |:     
Mouse    11 FAIHLLKVLCQDNPSKNVCYSPMSISSALAMVLLGAKGDTAVQICQALHLNPDEDVHQGF----- 70

  Fly    98 QVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFN----TLLYGATKELDFKNDPET 158
            |:|:.....|...::.       |:.|||:||:.|..:...|.    ...:...::|.|....|.
Mouse    71 QLLLHNLNKQNNQKYC-------LTMANRLFVENTCELLPTFKESCLKFYHSEMEQLSFAEAAEE 128

  Fly   159 GLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQ 223
            ..:.||.|::.:|:.:|.|:||.:.:...|.|:||||.|..|.|..:|:...|...||.||::|.
Mouse   129 SRQHINMWVSKQTNGKIPDLLSKDSVNSQTRLILANALYFHGTWCKRFEKNRTKEMPFKINKKET 193

  Fly   224 EMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNR 288
            ..|.||.:.........:.:|:|::.:||..|               |::.:::||:.. :.:::
Mouse   194 RPVQMMWREDTLFHAYVKEIQAQVLVMPYEGI---------------DLNFVVLLPDEG-VDISK 242

  Fly   289 VISRLNADSVKKWFERALPQKIE--LSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLT--A 349
            |.:.|..:.:..|.:.....:.|  :.|||||.::..::..:|..:|:..:|  :.:..||:  :
Mouse   243 VENNLTFEKLTAWTKPEFMNRTEFHVYLPKFQLQEDYDMNSLLQHLGILNVF--DGSKADLSGMS 305

  Fly   350 DPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILF 414
            ...:|.:.:..|...::|:|.|:.||||:.:........|||..|..:|||:|.|.....::|||
Mouse   306 TKENLCLSEFAHKCVVEVNEEGTEAAAASAVKFIFLCSGPDPETFCADHPFLFFIMHRTTNSILF 370

  Fly   415 AGVYSDP 421
            .|.:|.|
Mouse   371 CGRFSSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 102/392 (26%)
Serpinb9gNP_035585.2 SERPIN 4..377 CDD:294093 103/395 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.