DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and SERPINB7

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001035237.1 Gene:SERPINB7 / 8710 HGNCID:13902 Length:380 Species:Homo sapiens


Alignment Length:403 Identity:108/403 - (26%)
Similarity:188/403 - (46%) Gaps:53/403 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNL------GWALNKQQ 98
            :|...|.:::.:...:||:|||..|.:.||.|....:.:.:..::.:.|::      |.:.|.|.
Human    10 EFCFNLFREMDDNQGNGNVFFSSLSLFAALALVRLGAQDDSLSQIDKLLHVNTASGYGNSSNSQS 74

  Fly    99 VLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRT-------INVSNKFNTLLYGATKE-LDFKND 155
            .|.| .|.:...:........:||..|.:|.::.       |..:.|    ||.|..| :||.|.
Human    75 GLQS-QLKRVFSDINASHKDYDLSIVNGLFAEKVYGFHKDYIECAEK----LYDAKVERVDFTNH 134

  Fly   156 PETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINE 220
            .|...:.||.|:.::||.:|::::....|:...::||.||.|.||:|.|.|...||....|...:
Human   135 LEDTRRNINKWVENETHGKIKNVIGEGGISSSAVMVLVNAVYFKGKWQSAFTKSETINCHFKSPK 199

  Fly   221 REQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKIS 285
            ...:.|.|||:...|.:::.|....:|::|.|                ...|:|.::||.::   
Human   200 CSGKAVAMMHQERKFNLSVIEDPSMKILELRY----------------NGGINMYVLLPEND--- 245

  Fly   286 LNRVISRLNADSVKKWF--ERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLT 348
            |:.:.::|...::.:|.  .|...:.:|:..|:|:.|:..|:...|..:|:..:|..:.  .||:
Human   246 LSEIENKLTFQNLMEWTNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIFDESK--ADLS 308

  Fly   349 --ADPISLVIDDAQHLAKIKVDEVGSTAAAAT---ILLVSRSSRQPDPTKFNCNHPFVFLIYDEK 408
              |....|.|....|.:.|:|.|.|:.|.|||   |:    ..:.|..|.|..:|||:|:|  .|
Human   309 GIASGGRLYISRMMHKSYIEVTEEGTEATAATGSNIV----EKQLPQSTLFRADHPFLFVI--RK 367

  Fly   409 VDTILFAGVYSDP 421
            .|.|||:|..|.|
Human   368 DDIILFSGKVSCP 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 106/398 (27%)
SERPINB7NP_001035237.1 serpinB7_megsin 1..380 CDD:381032 107/401 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.