DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and SERPINA6

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001747.3 Gene:SERPINA6 / 866 HGNCID:1540 Length:405 Species:Homo sapiens


Alignment Length:425 Identity:100/425 - (23%)
Similarity:185/425 - (43%) Gaps:58/425 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TIAALDKPELSFLNEFSQIFKG----ERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSS 76
            |:.|:| |..:::| .|...:|    ..||:.:|.|.:..:.|..|:|.||.|...||.:....:
Human    19 TVQAMD-PNAAYVN-MSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISMALAMLSLGT 81

  Fly    77 SEQTERELAQALNLGWALNKQQVLVSYTLAQRQDE------------FRWRQSPMELSSANRIFV 129
            ...|..:|.|.|             .:.|.:|.:.            |....:.:|::..|.:|:
Human    82 CGHTRAQLLQGL-------------GFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFL 133

  Fly   130 DRTINVSNKFNTLL--YGATKELDFK-NDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLV 191
            |.::.:...|:..:  |..::.|... .|..|..::||.::.:||..:|.|:.|.  :....:||
Human   134 DGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSG--LDSPAILV 196

  Fly   192 LANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIY 256
            |.|..:.||.|...|.:..|..:.|:::|.....|.||.::.......|..|..|::::.|    
Human   197 LVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDSELPCQLVQMNY---- 257

  Fly   257 KSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQ 321
                        ..:.::..|||:..|  :|.||:.|:.|::.:|.......:::|.:||.....
Human   258 ------------VGNGTVFFILPDKGK--MNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISG 308

  Fly   322 RLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSS 386
            ..:|..:|..||:..:||..|.|..:|.| ..|......|.|.::::|.|...|.:|.:.::.:|
Human   309 VYDLGDVLEEMGIADLFTNQANFSRITQD-AQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTS 372

  Fly   387 RQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            :   |.....|.||:.:|:|....:.||.....:|
Human   373 K---PIILRFNQPFIIMIFDHFTWSSLFLARVMNP 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 93/399 (23%)
SERPINA6NP_001747.3 alpha-1-antitrypsin_like 42..401 CDD:239011 92/395 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.