DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and AT1G64010

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001320592.1 Gene:AT1G64010 / 842704 AraportID:AT1G64010 Length:199 Species:Arabidopsis thaliana


Alignment Length:233 Identity:59/233 - (25%)
Similarity:104/233 - (44%) Gaps:47/233 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 YMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQS----QIIKLPYRTIYK 257
            |.||.|..:|....|..:.|.:.......|.:|   .::|   |:.:::    :::|||:|    
plant     2 YFKGAWEEKFHKSMTKDRDFHLINGTSVSVSLM---SSYK---DQYIEAYDGFKVLKLPFR---- 56

  Fly   258 SKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALP-QKI---ELSLPKFQ 318
                  ...::..:.||...||: .|..|:.::.:: |.|| .:.:..:| ||:   |..:|||:
plant    57 ------QGNDTSRNFSMHFYLPD-EKDGLDNLVEKM-ASSV-GFLDSHIPSQKVKVGEFGIPKFK 112

  Fly   319 FEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVS 383
            .|           .|    |:.:..|..|..|.::|     ...|.:::||.|:.|.|||.::..
plant   113 IE-----------FG----FSASRAFNRLGLDEMAL-----YQKACVEIDEEGAEAIAATAVVGG 157

  Fly   384 RSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            ..........|..:|||:|:|.::|..|:||.|...||
plant   158 FGCAFVKRIDFVADHPFLFMIREDKTGTVLFVGQIFDP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 57/228 (25%)
AT1G64010NP_001320592.1 serpin <1..195 CDD:393296 57/231 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.