DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and AT3G45220

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_190108.1 Gene:AT3G45220 / 823658 AraportID:AT3G45220 Length:393 Species:Arabidopsis thaliana


Alignment Length:441 Identity:113/441 - (25%)
Similarity:191/441 - (43%) Gaps:101/441 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EFSQIFKGERDFSLALMKQIREIYPSG-NLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWA 93
            |..:..:.:.|..:.|.|.:.....:| ||.|||.| .|.||....:.|.              .
plant     2 ELGKSMENQTDVMVLLAKHVIPTVANGSNLVFSPMS-INVLLCLIAAGSN--------------C 51

  Fly    94 LNKQQVLVSYTLAQRQDEFR--------------WRQSPMELSSANRIFVDRTINVSNKFNTLL- 143
            :.|:|:| |:.:....|...              ..:|.:.||:|..:::|::::....|..|| 
plant    52 VTKEQIL-SFIMLPSSDYLNAVLAKTVSVALNDGMERSDLHLSTAYGVWIDKSLSFKPSFKDLLE 115

  Fly   144 --YGAT-KELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITP--HTMLVLANAAYMKGQWL 203
              |.|| .::||...|...:.|:|.|....|:..|:::||.:.|..  .:||:||||.|.||.|.
plant   116 NSYNATCNQVDFATKPAEVINEVNAWAEVHTNGLIKEILSDDSIKTIRESMLILANAVYFKGAWS 180

  Fly   204 SQFK-----------VEETALK-PFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIY 256
            .:|.           ::.|.:| ||..|.::|.:.|.    ..||          :::|||    
plant   181 KKFDAKLTKSYDFHLLDGTMVKVPFMTNYKKQYLEYY----DGFK----------VLRLPY---- 227

  Fly   257 KSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKIELS----LPKF 317
                     .|.:...:|.|.||| ::..|..::..::  |..::.:..:|::..|:    :|||
plant   228 ---------VEDQRQFAMYIYLPN-DRDGLPTLLEEIS--SKPRFLDNHIPRQRILTEAFKIPKF 280

  Fly   318 QFEQRLELTPILSLMGVNTMFTRNATFGDLTADPI---------SLVIDDAQHLAKIKVDEVGST 373
            :|....:.:.:|..||:...|| :.:..::...|.         :|.:.:..|.|.|:|||.|:.
plant   281 KFSFEFKASDVLKEMGLTLPFT-HGSLTEMVESPSIPENLCVAENLFVSNVFHKACIEVDEEGTE 344

  Fly   374 AAAATILLVSRSSRQPDPT---KFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            |||     ||.:|...|..   .|..:|||:|.:.:||...|||.|...||
plant   345 AAA-----VSVASMTKDMLLMGDFVADHPFLFTVREEKSGVILFMGQVLDP 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 110/429 (26%)
AT3G45220NP_190108.1 plant_SERPIN 8..390 CDD:238998 110/433 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.