DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina7

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_112390.1 Gene:Serpina7 / 81806 RGDID:619833 Length:426 Species:Rattus norvegicus


Alignment Length:400 Identity:91/400 - (22%)
Similarity:171/400 - (42%) Gaps:53/400 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYT 104
            ||:..|.:::....|..|:||||.|...||.:..|.|...|:.::.:.|...        |....
  Rat    59 DFAFRLYRKLSVENPDLNIFFSPVSISAALAMLSFGSGSSTQTQILEVLGFN--------LTDTP 115

  Fly   105 LAQRQDEFR-------WRQSPMELSSANRIFVDRTINVSNKF----NTLLYGATKELDFKNDPET 158
            :.:.|..|:       :..:.:||...|.:|:.:.:....||    .||........||.| ...
  Rat   116 VKELQQGFQHLICSLNFPNNELELQMGNAVFIGQQLKPLAKFLDDVKTLYETEVFSTDFSN-VSA 179

  Fly   159 GLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEET-ALKPFFINERE 222
            ...|||.::..:|..:|..::  :::..:.:::|.|..:.|.||.:.|:|.:| ....|.:::..
  Rat   180 AQHEINSYVEKQTKGKIVGLI--QDLKLNIIMILVNYIHFKAQWANPFRVSKTEESSNFSVDKST 242

  Fly   223 QEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLN 287
            ...|.|||:...:...:|..|...::::.|                .::...:.:||...  .:.
  Rat   243 TVQVPMMHQLEQYYHYVDVELNCTVLQMDY----------------SANALALFVLPKEG--HME 289

  Fly   288 RVISRLNADSVKKWFERALPQK--IELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTAD 350
            .|.:.:::.::|||  ..|.||  :||.:|||......:|...|..||:...|..:|.|..:|.|
  Rat   290 WVEAAMSSKTLKKW--NHLLQKGWVELFVPKFSISATYDLGSTLQKMGMRDAFAESADFPGITKD 352

  Fly   351 PISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNC----NHPFVFLIYDEKVDT 411
            . .|.:..|.|.|.:.:.|.|:...|:.   .:.|..||:....:.    :..|:.:|.:::..:
  Rat   353 N-GLKLSYAFHKAVLHIGEEGTKEGASP---EAGSLDQPEVAPLHAVIRLDRTFLLMILEKRTRS 413

  Fly   412 ILFAGVYSDP 421
            :||.|...||
  Rat   414 VLFLGKVVDP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 89/395 (23%)
Serpina7NP_112390.1 serpinA7_TBG 48..425 CDD:381023 90/399 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.