DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and AT2G26390

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_180207.1 Gene:AT2G26390 / 817179 AraportID:AT2G26390 Length:389 Species:Arabidopsis thaliana


Alignment Length:425 Identity:106/425 - (24%)
Similarity:185/425 - (43%) Gaps:73/425 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EFSQIFKGERDFSLALMKQIRE--IYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGW 92
            |..:..:.:.:....|.|::.|  :....|:.|||.|....|.|....|:..|:.|:     |.:
plant     2 ELGKSIENQNNVVARLAKKVIETDVANGSNVVFSPMSINVLLSLIAAGSNPVTKEEI-----LSF 61

  Fly    93 ALNKQQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLLYGATK----ELDFK 153
            .::.....::..||:..|....| |.:.||:|:.:::|::..:...|..||..:.|    ::||.
plant    62 LMSPSTDHLNAVLAKIADGGTER-SDLCLSTAHGVWIDKSSYLKPSFKELLENSYKASCSQVDFA 125

  Fly   154 NDPETGLKEINDWIADKTHNQIRDMLSSE------EITPHTMLVLANAAYMKGQWLSQFKVE--- 209
            ..|...:.|:|.|....|:..|:.:||.:      ||...| |:||||.|.|..|..:|..:   
plant   126 TKPVEVIDEVNIWADVHTNGLIKQILSRDCTDTIKEIRNST-LILANAVYFKAAWSRKFDAKLTK 189

  Fly   210 ---------ETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHIST 265
                     .|...||.::.::|   |:....|           .|:::|||             
plant   190 DNDFHLLDGNTVKVPFMMSYKDQ---YLRGYDG-----------FQVLRLPY------------- 227

  Fly   266 PESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALP---QKIE-LSLPKFQFEQRLELT 326
            .|.|...||.|.||| :|..|..::.:::.:  ..:.:..:|   ..:: |.:||..|....:.:
plant   228 VEDKRHFSMYIYLPN-DKDGLAALLEKISTE--PGFLDSHIPLHRTPVDALRIPKLNFSFEFKAS 289

  Fly   327 PILSLMGVNTMFTRNATFGDLTADPIS---LVIDDAQHLAKIKVDEVGSTAAAATILLVSRS--S 386
            .:|..||:.:.||......::...|.:   |.:....|.|.|:|||.|:.|||.::.::...  .
plant   290 EVLKDMGLTSPFTSKGNLTEMVDSPSNGDKLHVSSIIHKACIEVDEEGTEAAAVSVAIMMPQCLM 354

  Fly   387 RQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            |.||   |..:|||:|.:.::....|||.|...||
plant   355 RNPD---FVADHPFLFTVREDNSGVILFIGQVLDP 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 103/413 (25%)
AT2G26390NP_180207.1 serpinP_plants 8..386 CDD:381001 103/417 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.