DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and CCP3

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_180096.3 Gene:CCP3 / 817062 AraportID:AT2G25240 Length:385 Species:Arabidopsis thaliana


Alignment Length:430 Identity:118/430 - (27%)
Similarity:190/430 - (44%) Gaps:87/430 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EFSQIFKGERDFSLALMKQIREIYPSG-NLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWA 93
            |..:..:...|..:.|.|.:.....:| ||.|||.| .|.||....:.|              .:
plant     2 ELGKSIENHNDVVVRLTKHVIATVANGSNLVFSPIS-INVLLSLIAAGS--------------CS 51

  Fly    94 LNKQQVL----------VSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLL---YG 145
            :.|:|:|          ::..|||..|. ...:|.:.||.||.:::|:..::...|..||   |.
plant    52 VTKEQILSFLMLPSTDHLNLVLAQIIDG-GTEKSDLRLSIANGVWIDKFFSLKLSFKDLLENSYK 115

  Fly   146 AT-KELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITP--HTMLVLANAAYMKGQWLSQFK 207
            || .::||.:.|...:.|:|.|....|:..|:.:||.:.|..  .:.||||||.|.||.|.|:|.
plant   116 ATCSQVDFASKPSEVIDEVNTWAEVHTNGLIKQILSRDSIDTIRSSTLVLANAVYFKGAWSSKFD 180

  Fly   208 -----------VEETALK-PFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKE 260
                       ::.|::| ||..|..:|   |:....| ||          :::|||        
plant   181 ANMTKKNDFHLLDGTSVKVPFMTNYEDQ---YLRSYDG-FK----------VLRLPY-------- 223

  Fly   261 THISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKI----ELSLPKFQFEQ 321
                 .|.:...||.|.||| :|..|..::.::.::  ..:|:..:|...    ...:|||:|..
plant   224 -----IEDQRQFSMYIYLPN-DKEGLAPLLEKIGSE--PSFFDNHIPLHCISVGAFRIPKFKFSF 280

  Fly   322 RLELTPILSLMGVNTMFTRNATFGDLTADPIS---LVIDDAQHLAKIKVDEVGSTAAAATILLVS 383
            ....:.:|..||:.:.|.......::...|.:   |.:....|.|.|:|||.|:.|||.::.:||
plant   281 EFNASEVLKDMGLTSPFNNGGGLTEMVDSPSNGDDLYVSSILHKACIEVDEEGTEAAAVSVGVVS 345

  Fly   384 RSS--RQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            .:|  |.||   |..:.||:|.:.::|...|||.|...||
plant   346 CTSFRRNPD---FVADRPFLFTVREDKSGVILFMGQVLDP 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 115/418 (28%)
CCP3NP_180096.3 plant_SERPIN 8..382 CDD:238998 115/422 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.